CAZyme Information: MGYG000004798_02577

Basic Information

• Species: Enterococcus_B hirae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_B; Enterococcus_B hirae
• CAZyme ID: MGYG000004798_02577
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000004798_16|CGC2	55551.51	4.7297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004798	2841576	Isolate	United States	North America

• Gene Location: Start: 56501; End: 57946 Strand: +

Full Sequence      

MFKEYKMPKDFLWGGAIAANQAEGAYQVDGKGISLADLHVFHADKTNAEIAEEQHKGMSL
AQLKANMTDEQGYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSIDWSRIFPTGDETEPN
EAGLAYYDALIDKIHELGMEPIITMLHYETPVDITLNYGGWHNRKVIDLFVKYGKTILDR
YKDKVKYWIVINQINLIQFEPFNSTAIPYDTVDHYEEASYQAIHNQFVASAKIYEYGKKL
NPEMQIGTMVADCTAYPFSCDPDDIILALRRNRMEYFYTDVQFRGEYPQYALNYFAENNI
HLEITEEDKAILQANTMDYLAISYYYSQMVDSKKNDLNPASVTPNPNLKANPWGWAVDPK
GLYHSLSQYWDRYGKAIIIAENGFGMYDQLENGKIHDDYRIDYLASHIEEMKRAMYDGVN
VIAYCAWGPIDIISCSSAQMEKRYGFIYVDLDNEGKGSGDRIKKDSFYWYKNVIESNGEN
L

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	478	1.9e-138	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	4	479	1	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	0.0	6	481	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.01e-170	4	481	1	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	9.59e-167	8	481	7	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.04e-164	3	481	2	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASV81451.1	0.0	1	481	1	481
AND73388.1	0.0	1	481	1	481
QKX72333.1	0.0	1	481	1	481
QKX69888.1	0.0	1	481	1	481
QNG06330.1	0.0	1	481	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	4.37e-165	6	481	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	1.00e-153	6	481	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
2XHY_A	1.37e-153	3	481	4	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F79_A	2.84e-153	6	481	6	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.21e-149	6	481	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	3.15e-162	4	481	5	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	4.04e-155	7	481	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	7.50e-153	3	481	4	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	7.78e-149	8	481	5	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	4.59e-148	8	481	6	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004798_02577.