CAZyme Information: MGYG000004799_01861

Basic Information

• Species: Schaedlerella sp900765975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella sp900765975
• CAZyme ID: MGYG000004799_01861
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1015	MGYG000004799_88|CGC1	117317.65	5.1816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004799	2888994	MAG	China	Asia

• Gene Location: Start: 5777; End: 8824 Strand: -

Full Sequence      

MKNDQFANIAASGINVQSKELEVVTPPQNEAGELWSEQGGEYCVFPEKIESKEKLYEELE
RQKRYYAPYFMHYAPEMENLRERTYLTQFQWRKCEKDNWEEVTIPHYVGLLGTKTIYYRT
KFKVQKREGKALFLHFDGVDYITRVSVNGKFVGLHEGFFAPFEFDVTDYVIDGDNALIIE
VINDFVQQGNVETQGGERTGGDKIYAATGLGYDDPVMGWHHCPPAMGIYQKVYLEERNRC
FVQDIFIRPCVEEKCGEIWLEIYKCGPGREDISIEYSLYGENFEAIVFENKSYIPYTSRA
IGLGDTFTEAKLIGEGLIDKPIKLYMEKGVNYLRIPFEFPEFRLWNSKNPYLYEMQIRLK
NKEGNIIDTTRQSFGMRSFIMDTEEIPRGTFYLNGEKIRLRGANTMGHEQQCVLKGDYDQ
LYQDLLLAKVCNMNFLRLTQRPVQKEIYDYCDRVGLMIQTDLPLFGVLRKNQMIEALKQT
QEMEKLIRSHPCTILVSYINEPFPNAFNQPHRHLNRKELMEFFDCADIVVKMQNPDRVIK
HVDGDYEPPSKSLPDNHCYTCWYNGHGIESGKLHKGYWIPTKKDWNFACGEFGAEGLDSL
EIMKKYYPNEWLPQTEEEEMTWSAGSIMGAQTGNFHYFFYDTPHTLKGWVEGSQKYQAWA
TKWMTEAFRRNPRMVSFAIHLFIDAFPAGWMKAIMDVERNPKPAYFAYRDALSPVLVSLR
TDRYSCYEGERIPIEIWICNDLPHKLEGYQCYYDVISEDGKVLSHGEKEVYIAESDSYCI
GTLQTDSAGAGKKMIVRAAVKDSAGNFLHTNQEEIQVYPRNMTKSLNKKLALLNGEGIAA
QLIRESGCKHVDLVGTGEKTIILLDRYEDYLENQAEIDRKILEGAKVIFLELDEGEYTIA
EKSVQIKNSSMLPMNFVSLNTGDALVRDFRDRSFWNWYDEESDMIVPILESTIQAEGLEA
ILLSGNTDKKGNWGQATAVGRIRFGRGEVIICQMKLVGKMKKNPAAELFFERLIQ

Enzyme Prediction     

No EC number prediction in MGYG000004799_01861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	88	794	1.2e-77	0.6981382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.56e-27	91	502	34	407	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.10e-23	116	462	112	400	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	1.49e-20	107	502	63	418	beta-D-glucuronidase; Provisional
PRK09525	lacZ	2.63e-12	118	456	124	408	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.34e-10	99	183	55	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96176.1	0.0	1	1014	5	1046
AEE97824.1	0.0	2	1014	21	1049
QUI23767.1	0.0	2	1009	5	1027
QNK56944.1	0.0	4	1014	21	1066
QDH23079.1	0.0	2	1014	8	1038

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.34e-23	118	793	84	725	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
3OB8_A	7.09e-19	134	575	134	552	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
7VQM_A	1.20e-18	115	597	95	503	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
3DEC_A	1.20e-18	118	458	126	407	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.59e-18	118	456	130	409	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	6.18e-23	95	495	28	381	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P06864	3.73e-20	128	501	124	449	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
T2KPJ7	9.20e-20	98	709	78	625	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O52847	4.37e-19	117	503	137	483	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P24131	6.80e-19	118	503	125	461	Beta-galactosidase OS=Clostridium acetobutylicum OX=1488 GN=cbgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004799_01861.