CAZyme Information: MGYG000004802_00414

Basic Information

• Species: UMGS1384 sp900551265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; UMGS1384; UMGS1384 sp900551265
• CAZyme ID: MGYG000004802_00414
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	MGYG000004802_14|CGC1	59738.56	5.2023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004802	2084927	MAG	Spain	Europe

• Gene Location: Start: 19777; End: 21342 Strand: +

Full Sequence      

MLRVKILGADGSYVTRDEIVSLYASDMDYVPYIRKASVDYDATVNLEVPQGPVILHAKLR
VPGYGYGMWIMSDNCGEGYGPDAEVDFIHDAAASRIHEVEVVLGTKEFDPSPKCLSMLRD
AKSLLTLSEANPAKAPAYNMLALASAMWSGELAVVERARARIQKRGRRDDILFGAGGFSY
PYDGAIGWRKRGVKAPDYKGLPSMKENFDSVFNYATLPFYLADLEPEYGKPDFSYLDHLQ
DEFEKAGITTKGHPLWWAHTAGMPPWTKDLKWEDGSIKREIDRTISRTVKRYRGRIHYYD
AINENHDWCNSYNLTQDQQTMMTKYCCDAMHEADPDVHAVVNTCFMFGENAADGRTQWGP
TWERNLVPYTAIEKLEELGTQYEAIGMQLYNPARDMLAIDKMYDRFKKFGRRVHLTELGV
PSFEKDVRPNTTPGDIYCLKYMYYGLWHEMGWNERLQADWVEQFYTVTYSHPEVEAITMW
SVSDPGYVPASGLFTEDFEPKESFFRLKELEKSWGFDFGKK

Enzyme Prediction     

No EC number prediction in MGYG000004802_00414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	219	507	1e-32	0.8448844884488449

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	5.14e-19	224	507	6	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.43e-14	224	509	49	310	Glycosyl hydrolase family 10.
COG3693	XynA	1.38e-13	224	509	72	339	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	0.004	224	259	37	78	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW97941.1	6.40e-106	2	512	4	488
AGI38568.1	6.40e-106	2	512	4	488
AGC67515.1	6.40e-106	2	512	4	488
ANX00491.1	1.01e-104	2	512	4	488
EMS72420.1	1.09e-94	1	511	4	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1N82_A	4.75e-08	224	506	52	327	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	4.75e-08	224	506	52	327	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	2.64e-07	224	506	52	327	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	2.64e-07	224	506	52	327	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49942	7.78e-09	197	513	53	375	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P45703	1.10e-08	224	510	52	330	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004802_00414.