CAZyme Information: MGYG000004802_01309

Basic Information

• Species: UMGS1384 sp900551265
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; UMGS1384; UMGS1384 sp900551265
• CAZyme ID: MGYG000004802_01309
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000004802_84|CGC1	40799.34	4.3131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004802	2084927	MAG	Spain	Europe

• Gene Location: Start: 4483; End: 5577 Strand: +

Full Sequence      

MRRIISAVMVVMVFSLIMVPAAATAEEIRILYEGQEVTFPHGIEPVNGVATAALSDLVDA
IGAQCSFEPSSKRITLRFGEHCLRLSVGSAYAHENGQELTLQSAVFCRDGTVFVPVEDVM
SSLRMGYYTDAETKTIYITRGACEDRIPADVNVPILMYHAVSDDLWGSAELFVSPAEMEK
QLAYLQENGYTTITFEDLPRLDEIEKPILLTFDDGYRDNYTELFPLLQKYEAKATVFVIT
DAIGNDLYLTPEMIAEMSESGLVSIQSHTDTHPDLDTLNEEDTRREMLDSQLKLMRITGK
QPFVLCYPTGKYSDTTLEVIGDYYAYGLKMNGGIYNTSDDPYRINRVYISRYTDISAFAA
KIKT

Enzyme Prediction     

No EC number prediction in MGYG000004802_01309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	205	321	1.1e-30	0.8461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	1.06e-51	207	351	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	5.17e-40	175	347	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	6.44e-35	205	323	6	119	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10970	CE4_DAC_u1_6s	8.70e-34	208	364	3	160	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
COG0726	CDA1	1.35e-31	154	319	2	174	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR62058.1	2.98e-40	153	363	13	241
QYR65360.1	1.62e-39	153	363	13	241
QYR68238.1	1.23e-38	153	363	13	241
QYR55309.1	1.83e-37	153	363	13	241
ALF21261.1	2.57e-37	153	363	13	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V33_A	1.68e-37	134	363	129	360	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
4HD5_A	6.34e-37	134	363	129	360	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
6GO1_A	7.56e-34	146	363	93	318	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
6DQ3_A	2.97e-30	151	349	7	215	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4U10_A	6.41e-12	155	356	6	257	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	8.70e-35	153	364	65	277	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q04729	2.46e-10	202	323	63	181	Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus OX=1422 PE=3 SV=1
Q6TYB1	1.00e-09	165	363	65	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
Q5HKP8	1.00e-09	165	363	65	280	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
P75906	1.07e-09	156	269	52	185	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000197	0.999147	0.000153	0.000165	0.000153	0.000143

TMHMM  Annotations     

start	end
5	24