CAZyme Information: MGYG000004803_00497

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; HGM13010
• CAZyme ID: MGYG000004803_00497
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	MGYG000004803_42|CGC1	66912.19	8.258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004803	1382739	MAG	China	Asia

• Gene Location: Start: 5601; End: 7376 Strand: +

Full Sequence      

MKFAWFLPVLLAGYLIWVGMPFAIACAEQTLGQNRGKQTFMTRVDALLLLAIMLIYGGTA
FYDLGDTAAPQTFYEFPAAGSSVTLELSEPEVVSEVLYYTGLNTGSYTLSVSMDGDAWRD
VATLEQKHSMLFSWRVPETGAFAARYVRLTADNRLFLGSFVLRDAKGNPIALTAQDSSAE
ALLDESEVTPESPSYRNSTYFDEIYHARTAYENVTNVYPYEISHPPLGKLILSVGIRLFG
MTPFGWRCMGTLTGVLMLPVLYLLLKRMFGSTEISACGTVIFAFDFMHFVQTRIATIDSY
AVFFILLMYYFMYRFVTERKLSCLALSGISFGLGAASKWTCIYAGAGLAVLWLLHWIFRL
RREKDAGAFVKNVLFCLVFFVVLPGCIYYMSYYPYGKAIGLQGVSMYFDPDYAKLVWNNQ
VSMLTYHVGVNASHPYSSRWYQWIFDARPILYYLNYGSGDMKSAIAAFVSPLLCWGGIFA
IVGMVYLTFWKRDKKAGFILIGYLAQLVPWMFIGRITFEYHYFACTVFLLLAVCYVLDVI
VRTGKHGKRYLYSFTGLSVLLFAAYYPVLSGMWATMGYTGNFLRWFPSWPL

Enzyme Prediction     

No EC number prediction in MGYG000004803_00497.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	195	395	4.3e-55	0.9237668161434978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	1.55e-18	417	587	4	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	8.77e-16	197	393	46	265	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.10e-14	420	589	505	693	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	5.48e-14	194	394	16	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	1.16e-11	220	468	132	351	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	4.17e-154	11	590	23	652
QQR07704.1	4.17e-154	11	590	23	652
ALP95330.1	2.04e-153	41	590	72	751
QBB67038.1	4.06e-153	41	590	72	751
QIA32159.1	1.32e-151	11	590	19	648

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	9.47e-26	201	589	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	9.47e-26	201	589	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.26e-24	192	589	58	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	5.74e-21	222	589	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
O67270	2.02e-06	198	365	31	196	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
46	65
243	265
294	316
336	358
370	392
467	489
496	518
522	541
554	576