CAZyme Information: MGYG000004804_01295

Basic Information

• Species: Dialister sp900759415
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900759415
• CAZyme ID: MGYG000004804_01295
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201	MGYG000004804_31|CGC1	22793.95	5.6039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004804	1617976	MAG	China	Asia

• Gene Location: Start: 10765; End: 11370 Strand: +

Full Sequence      

MRTALKHRKREVHRHQGNTGAMVFTLFLALLCGLSLLILSDPRFLRPSEPVSHIIEQSAM
EENISPSLLEAVIRTESKFDEKAISHVGAVGMMQLMPDTAAWISETSGLPSDNLESPEQN
IPLGAWYLNFLLKKYHNNEVLALAAYNAGRGNVDEWIEKKGWPEGFNDIDQIPFPETREF
VKSVVHTEAWLEEERKDKNGR

Enzyme Prediction     

No EC number prediction in MGYG000004804_01295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	189	3.3e-30	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.00e-71	54	187	7	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.71e-57	43	184	1	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.59e-44	66	184	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.48e-37	63	168	9	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.69e-33	41	184	129	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	1.91e-97	1	198	1	198
AOH39655.1	7.71e-67	17	194	13	189
CCC73618.1	3.71e-46	53	188	12	150
AVO73570.1	9.81e-46	53	188	44	182
AVO26251.1	9.81e-46	53	188	44	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.29e-22	45	190	410	554	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.30e-22	45	190	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.32e-22	45	190	420	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.33e-22	45	190	424	568	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.34e-22	45	190	430	574	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.20e-21	51	185	60	176	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	1.33e-19	63	190	492	624	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	2.11e-18	64	190	493	624	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.11e-18	64	190	493	624	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	3.79e-18	63	185	440	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39