CAZyme Information: MGYG000004806_01263

Basic Information

• Species: Collinsella sp003487125
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp003487125
• CAZyme ID: MGYG000004806_01263
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808		92397.11	4.9269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004806	2202962	Isolate	United States	North America

• Gene Location: Start: 135911; End: 138337 Strand: +

Full Sequence      

MRVETTGVCRGNWKIYQQLKIEGIHKGSSIKAQAATDDDRRLPLSLLKFKDNNGESNSYV
LVIPDPDTRAIKIEFNEIGKDGCNLSSDSLSLNCKNIKWESRLNYKIKPDMCSKLRNYDD
VSEFEMATIDFWQCIEDSNEYILRCTVRTPYRNDSQIKLRCLDRFLNEVGLSIVNFGSNV
TSVGFTSEKKQLETQLSIRMPKAFDRYYFIIDDQNHPSFSAFDCLTPDKLGLLLEETNFL
FTHAQFDPEYPEWFTEHKATIGALEKQRKIVFNSAPKFSIIVPLYNTPISFFNDMAESVK
SQSYANWELILVDASPDNQELKARVEHEVARDNRIKSITLAENKGISENTNAGVAAASGD
FVSFFDHDDILEPDLLFSYAEAIENNDNVDLLYCDEDKLMPDGKLAQPFFKPDFNIDLLR
NNNYICHMLTIRKSLLDTLEPNTKEFDGAQDHNLTLRAVEKARNVHHVAKVLYHWRLSET
STAANADSKPYATIAGIKAVQNHLDRLGLNAKVEQARRPFTYKVTYAAPDSHPLVSIIIP
TKDYANILDNCITSIVEKSTYDNYELVIIENNSTENATFEYYDKLQAKYPDIVRLVTWEH
EFNFSKLMNFGVARAKGNYLLLLNNDTEVITPNWIETMLGICAREDVGAVGAKLYYPDNT
IQHAGLCVTGGVAGHLCQSMPKDNWGYFALNDAQQDFSAVTAACIMTKRSEYEKVGGFTE
ELQVAFNDVDFCLKLREINDLIVYTPEVELYHYESISRGVENNTDKQIRFHKEVAYMNYR
WANYYVEGDPYMNPNFTVGEPGNRYYHL

Enzyme Prediction     

No EC number prediction in MGYG000004806_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	279	389	1.1e-20	0.6588235294117647
GT2	536	659	5e-20	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.10e-82	276	476	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.84e-34	537	754	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.11e-25	533	785	3	246	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
PRK10073	PRK10073	5.50e-21	273	413	3	139	putative glycosyl transferase; Provisional
cd06433	GT_2_WfgS_like	2.07e-19	279	482	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69456.1	0.0	1	808	16	823
ATP53720.1	0.0	1	808	16	823
QOY61387.1	0.0	1	808	1	809
ACV56016.1	0.0	15	808	1	794
ACV56006.1	1.11e-203	1	808	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.22e-08	279	395	8	120	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	8.35e-06	276	374	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	9.04e-128	253	798	344	890	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.00e-94	249	798	292	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	1.63e-13	276	518	4	252	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q9CMP0	2.05e-09	253	738	134	616	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q57022	2.25e-09	276	449	4	177	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004806_01263.