CAZyme Information: MGYG000004807_00737

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter
• CAZyme ID: MGYG000004807_00737
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651	MGYG000004807_8|CGC2	74348.28	5.2505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004807	2958602	MAG	China	Asia

• Gene Location: Start: 22221; End: 24176 Strand: -

Full Sequence      

MDSMEKSTQEGPRWLWYPGDMEIYHCMKQNFSREERGFDWPAYWHMDDWNKSVLFTKTAE
LSEKTSFTPYANGVGYMEVNGQKHPFGQKITCGPGKVEFSSLVGNMTGLPALYVEGDVIR
SDTTWRVTNYPTSPEISHQTPPVLPGWSPLYSKRELSPDDIPYREKECEPVSEKASTSAQ
GNPGTLYDFGRLVNGTVKLVSEKPVTLCYGESDLEALDERWCYYKEEHATTATRPRRRAF
RYLFIPGVKPGEVPLTAVHTYVDIPVKAKFHCDVELLNRIFDVSVETFRQCSGLFFLDGV
KRDRWVWAGDAYQSYVVNPYVFFDPEINKRTLLGLRGNLGIQQHLNTIVDYSLLWVLGVE
HQYQMTGDLAFIQEIFPKVEDLMDLCLSQTQEQGFIVGRPQDWTFIDWADIDKTGPVAAE
QVLFVKALETMAQLCHLTGRDGAEYARKAKELKENLNRYFWSEELGAYIDSYESGKNHVT
RHANIFAVVFDVASQKQKESIAKNVLLNPQVPQITTPYFQFFQLDALCRLGYLDQVMERI
KSYWGGMLERGAVTFWEEFDPSQQAPEQYAMYGDPFGKSLCHAWGASPVYLLGKYFLGVR
PTAPGYKTYEVKPVTRFFRELDCQVPVGDGVVRIVLKDGNLETSFQGGTPT

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	184	637	5.6e-97	0.9404761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.23e-23	270	595	6	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	1.41e-09	346	509	81	266	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	3.95e-08	112	488	56	487	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	7.22e-05	423	503	310	394	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam04685	DUF608	0.001	356	478	105	225	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXJ63303.1	1.18e-258	7	648	2	633
QNG04502.1	9.59e-258	7	648	2	633
QIV89127.1	9.59e-258	7	648	2	633
ASV80873.1	9.59e-258	7	648	2	633
QKX65396.1	9.59e-258	7	648	2	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.03e-140	14	648	20	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	6.62e-44	217	646	482	918	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	4.21e-41	235	597	168	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	2.65e-14	240	632	700	1108	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004807_00737.