CAZyme Information: MGYG000004808_01192

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B
• CAZyme ID: MGYG000004808_01192
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211	MGYG000004808_150|CGC1	23442.61	8.4079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004808	1820324	MAG	China	Asia

• Gene Location: Start: 3306; End: 3941 Strand: -

Full Sequence      

MAKRAARRPRARRGRKQSRRFGRWYRVVPLVLVGAVVVACIILAATPTTLARRTLYPVRH
AQDIQSSATRHGVDPLLVAAVIKCESNWDENAQSSAGALGLMQVMPQTSSELARMGLVDS
DTYDPTNLLDPATNIEYGTAYLAFLQKNLSSTDEVIAAYNAGMGKVEEWLAQPGELADNI
TYTETREYLRRVSEAYQGYRDSYPMGLEVDQ

Enzyme Prediction     

No EC number prediction in MGYG000004808_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	199	1.7e-29	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.92e-56	57	197	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.86e-50	55	200	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.62e-36	75	197	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.53e-32	64	180	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16893	LT_MltC_MltE	1.95e-31	63	197	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR81479.1	6.26e-73	20	208	5	193
ADK68420.1	5.70e-71	20	207	5	192
QOY61251.1	2.96e-69	14	209	3	205
AKT50021.1	7.74e-59	45	204	17	176
BCV18677.1	3.51e-58	20	210	187	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.61e-16	52	192	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.62e-16	52	192	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O1J_A	1.62e-16	52	192	408	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.63e-16	52	192	418	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.63e-16	52	192	424	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.67e-19	64	196	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	9.55e-17	56	196	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	9.55e-17	56	196	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P0AGC4	4.20e-15	80	199	500	624	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	4.20e-15	80	199	500	624	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999844	0.000169	0.000001	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
24	46