CAZyme Information: MGYG000004812_01074

Basic Information

• Species: UBA1822 sp002314995
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp002314995
• CAZyme ID: MGYG000004812_01074
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559	MGYG000004812_8|CGC1	63491.11	7.6845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004812	1918692	MAG	China	Asia

• Gene Location: Start: 42521; End: 44200 Strand: -

Full Sequence      

MAYHLGDPDRFLPQKIVSSLCSFRLSGEKMNRTLRFPAILAIIFFFSLVCYLWGVQQMPV
TDPVESNYALTAKEMVLSGDWTSPQIYGTYWYDKPIFLYWLLSASYTVFGFSNFAARLPA
ALFGALAVTLMGWYASRILKDHASGIWAAVFLATSIEFWIISHAVITDSILLFFTLPTLF
SAYIGVTEKSWKHLTIAWAAAGFACLTKGPVGLVLPGMILFVWCLTRRSVRDVLRLFFPA
GILAFLLIAVPWYYTMYNLHGQVFLDQLIGLHNVTRALSSEHPEDNYFFYYLLVLPVALL
PWTGLSFYSMFRKWKDRDTLYNFLMIWCWGTILFYTLVATKYITYTYIAVPPAILLAVLA
LKDFLAEDGRKAQIALVGPYLLTLVALLAGTFYLPGNFISFYVIAAYSGFLLLTQWKKKQ
LGSMLILTTASMAVGLTCLVFGGLTNYVATRSSLDMAEYLHSLPGQHYFFKSYPPSYTYY
TDEIATRVYDEGMIRRDARWETKYAVPTVTTEELLSASEPVYLYVDNSDADTFSAWDGSR
RFTENKTLPGGVVYEMERP

Enzyme Prediction     

No EC number prediction in MGYG000004812_01074.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	39	436	2.8e-91	0.7277777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	6.58e-44	31	406	1	384	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.48e-24	31	426	1	420	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	6.55e-20	93	254	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.41e-14	65	253	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	2.28e-04	88	179	56	148	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	1.09e-186	40	556	29	550
AOH39318.1	1.81e-161	39	555	11	535
AXB83023.1	6.16e-130	38	525	5	505
AXL21032.1	6.13e-126	42	535	6	515
BBU37212.1	1.57e-118	34	533	1	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.85e-23	42	305	34	302	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CIH9	2.95e-30	41	356	10	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
B2K5L1	2.95e-30	41	356	10	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q1C744	2.95e-30	41	356	10	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnT PE=3 SV=1
A4TIM6	2.95e-30	41	356	10	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=arnT PE=3 SV=1
Q66A06	2.95e-30	41	356	10	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000012	0.000026	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
33	55
96	115
120	139
143	162
169	186
196	226
233	255
287	309
321	338
342	361
374	393
397	414
421	443