CAZyme Information: MGYG000004812_01075

Basic Information

• Species: UBA1822 sp002314995
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822; UBA1822 sp002314995
• CAZyme ID: MGYG000004812_01075
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MGYG000004812_8|CGC1	57219.29	7.6992

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004812	1918692	MAG	China	Asia

• Gene Location: Start: 44149; End: 45663 Strand: -

Full Sequence      

MASDRKYLFIYCLILFLLFLWNVPLLDPDEPVYGETAKEMLATGDFLSPRIYGEFWYDKP
PLFYWLEAASFSILGISTFSARLPSALIGALTVLYVWYETEKLFSRRTGFLAAAILATFL
EFTVLARSAVTDMTLTAALTVALFSFVRQNYVPAYIACGLALLAKGPIGFGFPALIVALW
LLAQKKFTLRPIMALRWYWGIPLACLVGLPWYIYMTAVHGQPFIDTFLGYHNLVRFTAPE
HVGKDHWWLYLVVLTAGCFPWTGAVCGMLTRLRDFARDPVKLYFIVWAAFIFLFFSASST
QLFSYILPMYPALAVLTALYLEEIFDGRRSRFFTQLHLFFIAITAAALGMAPLTPAGGDF
GKYGTVLVLLLLGLLGVRTFQWRHFRTFLLVQGALALCLTVAAWTLFAAPVREAFTSADL
SMRVQLTEREDAPLYIDPFYRPASAFYHDLYGLRMPDELTPSEQVPDGSYLLVQKKITDD
WSPKEHAQWHIIWETPTASFLRKL

Enzyme Prediction     

No EC number prediction in MGYG000004812_01075.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	8	487	5e-112	0.9296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.47e-50	8	354	13	369	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.74e-35	1	357	1	373	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.77e-17	58	187	1	138	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	4.54e-17	8	214	3	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	4.92e-05	17	183	27	190	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	5.19e-185	8	503	10	527
AOH39317.1	8.75e-167	13	503	17	527
ALG41392.1	1.86e-110	14	501	20	515
AVO73979.1	1.47e-109	14	501	20	515
CCC72524.1	1.47e-109	14	501	20	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.53e-27	25	324	54	367	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	5.55e-33	5	323	2	309	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
O67270	6.12e-30	28	323	28	323	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
C6DAW3	2.49e-29	27	355	32	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
C5BDQ8	3.63e-28	27	324	29	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
Q6D2F3	6.80e-28	27	355	32	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000000	0.000013	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26
75	97
109	131
151	182
195	217
247	269
282	299
303	325
332	354
364	382
389	411