CAZyme Information: MGYG000004813_01197

Basic Information

• Species: Proteus sp003144505
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp003144505
• CAZyme ID: MGYG000004813_01197
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		22723.77	8.1188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004813	3063039	MAG	China	Asia

• Gene Location: Start: 397; End: 1008 Strand: +

Full Sequence      

MKKNKLMVFTATLLLSSAGFISTALADVTLKHGYIDKPPSRAFLCSSKGNNLNKNCGDIQ
YEPQSVEGPKGFPETGPKDGEIASGGKAKFSQLNQQSADRWHKVDIKSGEYTFKWTLTAP
HSTASWRFFITKPEWDVNKPLTRDDFDLTPFCQRFDNGTVPMKTVELNCNIPKRTGYQVI
LGVWDIADTGNAFYQVIDAEFKE

Enzyme Prediction     

No EC number prediction in MGYG000004813_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	32	199	1.6e-57	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	1.57e-108	1	202	3	194	N-acetylglucosamine-binding protein GbpA.
COG3397	COG3397	1.62e-83	1	203	1	209	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21177	LPMO_AA10	5.64e-81	32	198	1	178	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
pfam03067	LPMO_10	3.91e-65	32	198	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	2.95e-09	65	198	5	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV22695.1	7.01e-148	1	203	1	203
QHN11991.1	6.87e-130	1	203	1	203
QPT32813.1	1.14e-128	1	202	1	202
AZG99961.1	6.58e-128	1	203	1	203
QPN90989.1	9.35e-128	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	1.59e-71	32	203	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	3.70e-70	32	203	1	170	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	2.59e-65	32	198	1	163	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
6T5Z_A	6.13e-65	32	198	1	168	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5L2V_A	1.56e-63	32	199	1	162	Catalyticdomain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S],5L2V_B Catalytic domain of LPMO Lmo2467 from Listeria monocytogenes [Listeria monocytogenes 10403S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87FT0	2.39e-61	21	201	10	201	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
A1JQE6	2.78e-61	1	201	1	192	GlcNAc-binding protein A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=gbpA PE=3 SV=1
Q8GBD4	2.78e-61	1	201	1	192	GlcNAc-binding protein A OS=Yersinia enterocolitica OX=630 GN=gbpA PE=3 SV=1
Q6LKG5	3.14e-58	30	201	23	202	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q9KLD5	8.18e-58	15	201	7	201	GlcNAc-binding protein A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=gbpA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000197	0.999178	0.000171	0.000162	0.000147	0.000134

TMHMM  Annotations     

start	end
7	29