CAZyme Information: MGYG000004813_01801

Basic Information

• Species: Proteus sp003144505
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp003144505
• CAZyme ID: MGYG000004813_01801
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		40651.93	5.3979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004813	3063039	MAG	China	Asia

• Gene Location: Start: 219; End: 1280 Strand: -

Full Sequence      

MEHANTEALQKGIVLQNMKRVYHYQSANQVRSVRRRSGKTRFIKDTDWERGVLWSCVSAA
WQATQDEEYLNGVLNYTLHTGFRTGPNARFADDHVCAQAYLAISPLFEQLEVIEPTIKAF
DIMLNDPKPGREDWWWCDALFMAPPGFAALSEITGERRYLDYMHTAYWDAIEHLRDPETG
LIFRDHRYIPDGHGNEMREANGEKVFWSRGIGWVLASVPRILQYMPDDYHGRERYIVLFK
ELATSILDYQHEDGFWRTSLLDPDNFPAPESSATALFCYGLAWGINQGVLEKEVYFPALN
RAWVALQTCIHDNGMIGWVQLPAFNPREVKFEHNMDYGAGAYLLAGSEVLKLS

Enzyme Prediction     

No EC number prediction in MGYG000004813_01801.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	40	351	8e-84	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.09e-109	11	353	1	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.58e-72	47	352	28	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHN11506.1	1.26e-275	1	353	1	353
QIG05302.1	2.08e-265	1	352	1	352
QPT33222.1	5.96e-265	1	352	1	352
QKD68654.1	8.46e-265	1	352	1	352
QUT00818.1	8.46e-265	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	7.31e-81	43	352	48	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	7.55e-52	90	351	114	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	6.59e-46	90	351	97	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	2.70e-16	136	352	200	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	4.92e-80	43	352	55	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.19e-78	43	352	53	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	4.51e-64	91	350	136	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	9.78e-10	47	351	30	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004813_01801.