CAZyme Information: MGYG000004820_00425

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004820_00425
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000004820_29|CGC1	37006.09	9.1023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004820	2422420	MAG	China	Asia

• Gene Location: Start: 3292; End: 4278 Strand: +

Full Sequence      

MKTKIFFIAAATLFTMTAINVFADPANEPTPQTTAEDTASTPMPTVVSPPVPKTITFAGE
NIDFDRSDMYERLDRELSQMCYMHSSTMLMLKRANRYFPVIAPILKKNGVPEDLVYLACI
ESSLNQRAYSPAKAAGLWQFIASTAKQYGLEVNDYVDERYNIEKATAAAARYLKNSYAKY
GNWESAMASYNGGQARVTNELSSQLADSAFDLYLVEETSRYPFRVYAAKALMENPSKYGF
RLKASQFYAPIKYTEVTVNSTIDDLPAWAQQQGTTYAMLREYNPWLRAKSLPVTAGKSYT
IKIPKKESLSRSANTIQKQHLYNPRWAE

Enzyme Prediction     

No EC number prediction in MGYG000004820_00425.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	97	233	2.5e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	5.05e-57	105	229	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.60e-24	106	197	6	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	1.07e-22	65	306	76	313	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	1.92e-13	121	228	11	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	8.80e-12	97	197	6	111	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35372.1	3.11e-128	39	326	46	330
QCD43280.1	1.50e-127	46	326	48	325
ASB38769.1	4.49e-125	39	326	34	318
QQR09511.1	4.49e-125	39	326	34	318
ANU63153.1	4.49e-125	39	326	34	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	8.32e-21	71	308	79	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	8.32e-21	71	308	79	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000412	0.998727	0.000295	0.000209	0.000178	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004820_00425.