CAZyme Information: MGYG000004820_00696

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004820_00696
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		99518.88	4.8488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004820	2422420	MAG	China	Asia

• Gene Location: Start: 8964; End: 11645 Strand: +

Full Sequence      

MTIPKIHTTCAALTLLASLSAPLLNAQGQVPEPYEPLTGCTPGTQLQYSPDPLSGYVWDN
PQATDKLQIYELKPKAIICDKPEKMTATSGDSFTARGGCNVRFDFGVVSPGWLEIDCAGG
LPEGVTCSISEHNEPSRMNGTSQSQYKTKVPVKYGDSYRLELNNALYEGVRYGWVHIPAT
AGEVNITNVRLVCQAKPANYLGSFECDNTMLNRIWYTGAYTVRTNLLENCFGAILMERGD
RFSWTGDAYISQAAALVAFGNYDFIKKNIDHTSNQSNGIFSYELYWVQSVIDYYNYTGDT
EFLKKYKTNIYNKLARARNNWGAHPNLNYYGWDERLGAGFENGSCDENQLAYKMLCIQTW
RMAADVMRRIGNTRDADKYDGFIEKYSAMLEEDRSWINNLALFSATDAINAGTLTSDEIP
AVWDKIFSDRLQRLSYSPFNQFFVLNAMSRMNRHGEALHTIDDLWGGMIRYGGTTFFEVY
RPSWNDYALAENDPVPNCQVGFTSLTHPWSAGVTKWLSEEVLGIKPVKPGFDEFSVTPHL
TCGLTRVSGTVPTPKGEISFAIDTQAGSSRLTVPEGSTAAMAIPKMGAGVTGVKVDGNPV
EIASEDIYFAYLPQMGAGEHEVSFAYTSAIESPEPVETLHYPYEKPLVAEDTITKGDWRG
KYGKDGYFLFNYDGNDLHRSNLPAGCSVNMRLGGQYRYPGTEHDPRSLQSPDEWDPQRQV
GVFFTLDPADCLETMTLDLDYQPEVPYDLSFYFIDWERGTRRSAIEIFDLKTLQMIAPVQ
IVREYGSSRYITLRIDRPVRFRVNNIRGDNAAIAGMFFDKPASSLGTSAIDKDVEIIPGK
GEITVKATQDSLVTLHNISGEQTFSGIVHPGTTTLSPIEQGVYVVNGQKILVN

Enzyme Prediction     

No EC number prediction in MGYG000004820_00696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	98	580	3.5e-80	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.52e-13	202	521	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.15e-05	523	584	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam03663	Glyco_hydro_76	0.002	249	330	1	76	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA24541.1	8.07e-281	34	819	35	820
QMW04815.1	8.38e-245	24	819	27	816
ATP56756.1	3.85e-237	34	820	31	819
ACT93515.1	2.46e-231	24	819	44	831
QEC76313.1	7.78e-229	34	819	45	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.01e-34	147	576	253	690	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	7.47e-17	97	556	435	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	1.03e-09	465	601	766	896	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	8.80e-06	2	628	496	1173	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999057	0.000196	0.000171	0.000146	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004820_00696.