CAZyme Information: MGYG000004820_00787

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000004820_00787
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		96624.81	5.9136

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004820	2422420	MAG	China	Asia

• Gene Location: Start: 3025; End: 5619 Strand: -

Full Sequence      

MHKARIILTGIATVALASGAALNAATDLRCEYLTNPLGIDEKAPRFTWKASAGSGKTQVI
EVAESEKALRDRKFLWRSQPLSATTLSAIYAGKPLKSHTRYVWRVITDGKASETATFETA
KMQPHGWEASWITDGNDKEFEPAPMLRKDFNLDRVPDNARAYISAAGYYVLYINGRRVGD
SHMDPGYTHYDKRNLYATYDVTPLLRKGENTVATVLGNGFYNCQSKAVWDFETARWRNRP
SMIFELRGGEEGMPETLIAASDNSWRTATGPYTYNNIYSGDRYDGRLEPEGWMEPGFDAS
AWKPAKAVGAPSPLLKAQALPAIRPVETIRPKLIQSWGDTVYVFDMGKNIAGVAGLTAAG
ERGTAFKLSYGEMLRKDGRLEQGNIDIYYRPEKPGEKFQTDEFILGGKGEPETFTPMFTY
HGFRYVEVKSDRPVKLSEESLTGYFMHTDVKPAGSFSCSEPLLGKIHAATMLSYLGNIHS
IPTDCPQREKNGWTADAHVAVDLGLLNFDGITFYEKWMNDFIDNQRENGNISGIIPSDRW
GYGEWPGPVWDAALFIIPEAIYDYYGDTRVIERLYPTMERYFKWAASLEKEEGYLNNGIG
DWLSYSAQTPTDYTGTVYYYLDNVKMAKFASLLGEDPQPYIEKSRRLKDIINRRWFNEES
NTYATGTQAALGVALYAGIVPEGKEQAVADELHKAVAANGYHLDYGLLGSKTVPAMLTRY
GYVDDAYRMATLKDAPSWGYWIDKCGYTTLAETWTLSPEFRDASINHVFMGDISAWMTQA
LAGINHDPEHPGFANVIIRPYFPDGLYRAEGKYDSVRGTIVSRWVRKGDEVTLTVTIPGA
TTATVFAPEPQTVGSGTHTFKFSI

Enzyme Prediction     

No EC number prediction in MGYG000004820_00787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	338	845	5.7e-147	0.9861111111111112
CBM67	129	311	2.5e-42	0.9659090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.94e-103	453	781	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.39e-61	159	327	6	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	8.49e-27	338	447	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.28e-14	783	860	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48046.1	0.0	22	858	26	855
QUR50486.1	0.0	18	864	27	865
QJE27359.1	0.0	18	862	20	856
QIX67103.1	0.0	18	864	20	858
QKH99925.1	0.0	18	864	22	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	7.43e-137	27	849	34	900	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	7.31e-108	143	848	302	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.63e-97	31	860	10	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	3.48e-111	34	843	41	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	3.16e-107	143	848	302	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	6.87e-93	31	858	38	889	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	6.79e-89	31	848	42	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001149	0.997650	0.000435	0.000312	0.000217	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004820_00787.