CAZyme Information: MGYG000004822_01406

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004822_01406
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000004822_109|CGC1	35728.35	9.4868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004822	3489319	MAG	China	Asia

• Gene Location: Start: 8469; End: 9404 Strand: +

Full Sequence      

MKSIKLLIYICITISLANIFLIFCSAKKIASPKENFPIQETASFTSAFSDVRIPETFSFA
GEEVPLKRWDIQEALRKELIVNTYLHSHTIQILKTAPRTFSIIEPILKKNGIPDDFKYLA
VIESRLDPQVVSPAGATGVWQIMKKTAQELGLEVNEEVDERYHLEKSTEAACAYLKKAYN
KFGSWTLAAASYNAGSAMLSKQMDIQKQNDYYNLLLGEETERYVFRILALKQIMNLPQQY
NFNVSQLYPLEKTEKIVINGPVKDWADFAKAHGITYKTLKRFNPWLRKSSLRNPRHKTYE
ISIPVNKDLYQ

Enzyme Prediction     

No EC number prediction in MGYG000004822_01406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	239	9.3e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.16e-61	107	232	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	2.60e-26	102	214	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	9.83e-23	14	291	6	300	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	8.47e-21	119	229	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.95e-17	97	229	3	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY32428.1	2.31e-149	1	311	1	311
SNV32652.1	2.31e-149	1	311	1	311
QRO51442.1	8.74e-125	33	311	30	308
AZS32129.1	7.12e-124	33	311	30	308
QGY43333.1	4.62e-100	19	305	20	302

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.30e-23	55	291	58	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.30e-23	55	291	58	297	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002160	0.004138	0.993703	0.000007	0.000010	0.000008

TMHMM  Annotations     

start	end
7	26