CAZyme Information: MGYG000004823_00548

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_00548
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	MGYG000004823_21|CGC1	64707.15	9.6811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 21280; End: 22947 Strand: +

Full Sequence      

MWPLLIYDSEIMKAKHLHLLLLLVVCFFTFFINNRVIYTDIMESRNIITAREMVYDGHWM
VPTMNGELRLEKPPLPTWIAAGVEMVFPDDMGAQRAMAGLAATLLIFFFYLLGKELTKNN
KYALVSSLVLCTSYNIILMGRTASWDIYCHAFMMGALYFLYKGLQKEGRQWGNFLGAGIF
LGLSFLGKGPVSFYALLLPFLVSYTLFLRRSLRKKGLPIFVMILVCLLISSWWYLFIYLF
HAEEARYVLDKESTAWVERNVRPWYYYGTFFLETGIWALMVLITLAVPYWNRKIRQHREY
LFALCWMLFLVIFLSFLPEKKNRYLLPVLIPAAYTIGFLFIHWTEEIKKRRLDKTGKWFY
LVNSGLVTLILFALPVVGYFTLYQKEMLSLSSLILLTVLIWGLAIFMVTSMTRLRPMRFL
SGVVILFIIAELFCMPYIGGLVNNPEFRSISGTREVEALKPLPFYSVAGQELRIELVYEA
NKKIRPLDINHTEEVMKALPCAILTHGRVGEELPATLWEKVDTTWVGHYDNNRRPKNTKR
YSDMFLYNVTILKKK

Enzyme Prediction     

No EC number prediction in MGYG000004823_00548.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	14	451	2.3e-72	0.812962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.26e-36	24	443	16	433	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.45e-17	50	404	40	398	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.50e-14	72	234	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.51e-05	65	244	54	243	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	0.001	102	444	122	494	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF51769.1	9.70e-25	14	401	2	385
BAI80457.1	1.88e-22	43	448	32	418
AAC07235.1	2.72e-22	43	366	30	346
ACB50888.1	6.13e-22	40	418	51	472
CBX27700.1	1.21e-20	43	350	34	355

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	5.45e-23	43	366	30	346	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A8FRR0	1.60e-11	43	337	34	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
O67601	1.90e-10	19	372	5	328	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999706	0.000285	0.000005	0.000001	0.000001	0.000035

TMHMM  Annotations     

start	end
17	39
91	113
122	139
144	161
174	196
216	238
268	290
300	317
324	343
358	380
387	409
419	441