CAZyme Information: MGYG000004823_00915

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_00915
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000004823_42|CGC1	38691.42	7.2004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 20909; End: 21934 Strand: -

Full Sequence      

MCDKIKQNFGQTPKVFRNSSLIYSDEIGAQVAAMGFKGMLTEGAKHILGWKSPHYLYHCN
QNPNLKLLLRDFKLSDDICLRFSNSDWDAYPLFADTYIDWIAALPEEEQVINIFMELCAL
GLAQPLSSNILDFLKALPAVAKERGINFSTPSEICSKLKSVGQIDVQYPLSWVDEERDIS
CWLGNIMQREAFNKLYSVAERVHLCSDRRIKQDWDYLQASNNFRFMTTKQSNIGLNRGIY
DSPYDAFTNYMNILGDFISRVNALYPVDMENEELNSLLTTIKNQGEELVALNKEVDKLQV
KLAKYEGKAAKEDVAKKVLAKKAVTKKNVAAAAKKPVTKTE

Enzyme Prediction     

No EC number prediction in MGYG000004823_00915.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	3	201	9.5e-26	0.5039164490861618

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	1.12e-93	1	185	125	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
COG1449	COG1449	2.34e-42	3	292	227	534	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
pfam03065	Glyco_hydro_57	6.49e-30	3	167	133	293	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
cd01022	GH57N_like	6.00e-10	6	184	126	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR68033.1	6.63e-190	1	310	127	436
AII62974.1	6.63e-190	1	310	127	436
QUT83885.1	6.63e-190	1	310	127	436
QJR63770.1	6.63e-190	1	310	127	436
QJR72368.1	6.63e-190	1	310	127	436

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	1.32e-51	6	264	131	399	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_00915.