CAZyme Information: MGYG000004823_00940

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_00940
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	MGYG000004823_44|CGC1	82590.11	4.9211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 10799; End: 12946 Strand: -

Full Sequence      

MERMPKATWIWYPGDYEIWLGNKMNNRRTERGAFFPPFWKMDSHYVTVEFSKKLDLQQAE
EILIAVEGTYNIKLDGKLQFGMPERFTLPAGKHSLNIKVWNQATPPALYIKGETVYTDTT
WKVTYEDKEWIDESGKASDTSATVYMDAGCWNFDEPAERPSQFRLNCQLQAAVEKKDVPG
GTLYDFGKETFGYLLLKQVSGKGDFCIYYGESPEEATDTLYGETLDKIRVDGDTITDLAL
NHTVSLTEDYLLENSKAFRYVYVTLGEGVRLGDVMMHYEYLPVTYRGTFKCNDEELNKIW
EVGAYTMHLTSREFFIDGIKRDRWVWSGDAIQSYLMNYYLFFDSDTVKRTIWLLRGKDPI
TCHTNTILDYTFYWFLSIYDYYMYTGDKHFVSQVYPRMQTMMDYVLGRTNADGMVEGLTG
DWVFVDWADFPMSKQGALAIEQILFCKSLETMQLCAGLMEKNEDVTKYSKLAADLRAKLL
PTFWNEEKQAFIHNVEKGKRSEQINKFPNMFAITLGYLDEEKKASVMKNVMLNEDVLKIT
TPYMRFYELEAMCAMGYQTQVMQEMKAYWGGMLNEGATSFWEKYNPEESGTQHLAMYGRP
YGKSLCHAWGASPIYLLGKYYLGVKPVKEGYKEFSVTPVLGGLEWMEGSVPTPAGAIQVY
MDKEVIKVKATEGKGYVYISSSKQQPEASVGTIEKTDDGRYRLWIDTREEVTIKY

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	178	665	2.6e-113	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.50e-23	287	620	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	5.42e-08	365	530	81	259	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	3.85e-06	366	487	336	465	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	7.20e-05	623	659	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG4354	COG4354	0.003	376	487	449	568	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92124.1	0.0	8	710	22	727
QUT23612.1	0.0	8	715	46	756
ALJ42159.1	0.0	8	715	17	727
AAO76108.1	0.0	8	715	17	727
QQA06603.1	0.0	8	715	22	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	0.0	8	715	19	729	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.96e-49	248	655	495	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	6.83e-33	292	620	212	541	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_00940.