CAZyme Information: MGYG000004823_01728

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_01728
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000004823_100|CGC1	31231.59	5.2783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 7884; End: 8699 Strand: +

Full Sequence      

MSTLDNRNTFPQIEYLADAYKLTEDERYREAALKGLNYLLATQKENGGWRGWDVDAITFN
DDVTTGALELFQKIVLGDKSFSWLDASTLAKIKEGYEKGIAMILRCQVVQNGAKTAWAQQ
HDNETLFPVKARTYELPAITANESCEVLKLLMNIPNPSKEVVESVKAGMAWLDKVKIQGL
RIAKVPLPEEKIINHEYPYDQIEVRDEKAEPIWARFYEVADNTPFLCTRAGQKVWKLADV
NAERRTGYAWYGYWPKEIFGLYNEWLKREHL

Enzyme Prediction     

No EC number prediction in MGYG000004823_01728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	2	257	7.3e-91	0.8784722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	2.91e-89	2	259	35	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	2.26e-87	2	258	39	289	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam13243	SQHop_cyclase_C	0.002	21	71	82	149	Squalene-hopene cyclase C-terminal domain. Squalene-hopene cyclase, EC:5.4.99.17, catalyzes the cyclisation of squalene into hopene in bacteria. This reaction is part of a cationic cyclisation cascade, which is homologous to a key step in cholesterol biosynthesis. This family is the C-terminal half of the molecule.
TIGR01507	hopene_cyclase	0.003	21	80	394	470	squalene-hopene cyclase. SHC is an essential prokaryotic gene in hopanoid (triterpenoid) biosynthesis. Squalene hopene cyclase, an integral membrane protein, directly cyclizes squalene into hopanoid products. [Fatty acid and phospholipid metabolism, Other]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37157.1	1.23e-108	2	266	97	361
QDU41600.1	2.65e-96	2	268	122	389
QDT46035.1	4.28e-95	2	265	122	386
QDU80650.1	2.64e-92	2	268	119	386
QIL89063.1	4.51e-76	2	268	109	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.40e-45	1	268	143	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.76e-29	3	261	70	325	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.48e-28	3	261	70	325	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_01728.