CAZyme Information: MGYG000004823_01729

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_01729
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000004823_100|CGC1	61048.38	6.1479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 8829; End: 10451 Strand: +

Full Sequence      

MNKLKCAAMGLALAACSFTSLSAQSSKMHEGVLKTMKTATQFMMDKVSYHGGFVWSYLPD
LSRSWGEMEAKRTMVWIQAPGTPLVGQLLLDAYHATGDEYYYEEAKKVANVLIWGQEPCG
GWNYMFDMAGENSMKEWYATVGKNGWRMEEFQHYYGNATFDDSVTSDVAKFLLRVYVEKY
DPAFRPALDKAIHFILESQYPVGGWPQRYPLMHDHVFQGKADYSSFITLNDDVIPDNIDF
LVQCYQALGLKNLKEPIMRALNMVIVLQQGAPYAGWADQYTVDDLQPAHARSYEPRSINA
GTTVGMIHKLCDYYKLTGETKFLSGIPAAIDFLESMKLPDSEVARFGRRPLEEGQILVPR
FINPEDGKPLYVHRKGTNAWNGTYYIDQDISNTIAHYSSASAINIESLRRYYEEAKATPK
EELAKNSPLLCNGLTPLPKYYVSYRPARRGAKPDTVEQIVKSITKEGSWLTPLTALSNPY
KPCPETNKQPSDETRYGSTFVGDEYDTSCYPAKEEVMGISTQVYVSNMAKLIQYITTNEK

Enzyme Prediction     

EC	4.2.2.2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	116	399	2.2e-129	0.9963636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02474	pec_lyase	3.06e-21	116	377	1	263	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam09492	Pec_lyase	2.03e-20	116	377	1	262	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
cd02889	SQCY	0.006	152	210	12	72	Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. Bacterial SQCY catalyzes the convertion of squalene to hopene or diplopterol. Eukaryotic OSQCY transforms the 2,3-epoxide of squalene to compounds such as, lanosterol (a metabolic precursor of cholesterol and steroid hormones) in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain. This group also contains SQCY-like archael sequences and some bacterial SQCY's which lack this minor domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR66990.1	2.69e-267	8	535	13	535
QJR71330.1	2.69e-267	8	535	13	535
QUT87327.1	2.69e-267	8	535	13	535
QJR62731.1	2.69e-267	8	535	13	535
AII65137.1	7.69e-267	8	535	13	535

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.88e-13	56	300	18	292	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.58e-11	109	307	37	223	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	1.60e-10	109	307	37	223	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000785	0.724769	0.273415	0.000367	0.000357	0.000289

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004823_01729.