CAZyme Information: MGYG000004823_02738

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_02738
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		41047.99	8.3533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 3204; End: 4256 Strand: +

Full Sequence      

MEQVSEEKCNEKKNRLAVVILNWNGLEMLRSFLPSVVQYSQQEGVAVYVADNASSDTSCE
WVEKEFPQVRIIRLEQNYGFAEGYNKALSEVSADYYLLLNSDVEVTENWLIPLLKYMDRH
PEAAACQPKLLSWYHKDQFEYAGACGGYLDKLGYPYCRGRIFDVVEKDEGQYDSIEPVFW
ASGAALMVRSDDYWANGGLDGRFFAHMEEIDFCWRLRHAGRKIYCIPQSKVFHVGGGTLN
KENPRKTYLNFRNNLFMLYKNLPAGQLYFILCIRAVLDYVAAFTFLLKGQVPNAKAVWKA
RWDFWQMRSYRKEARRNVWRHVQAERIPEQRPVSILWSYYVRRIKCFRSL

Enzyme Prediction     

No EC number prediction in MGYG000004823_02738.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	18	128	5e-21	0.6647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.52e-49	18	235	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.65e-48	15	318	4	297	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	5.11e-17	18	127	2	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.41e-16	18	143	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02526	GT2_RfbF_like	1.63e-11	46	258	26	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU05996.1	5.10e-156	12	350	17	355
QQT78972.1	5.44e-156	15	350	2	337
ASM67710.1	5.44e-156	15	350	2	337
QRP59721.1	5.44e-156	15	350	2	337
QDO67451.1	1.21e-151	14	350	2	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	7.41e-16	16	233	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	7.41e-16	16	233	5	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
D4GU63	7.79e-10	16	253	20	244	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P36667	6.42e-08	78	233	60	219	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
Q6WV16	2.14e-07	16	246	204	440	N-acetylgalactosaminyltransferase 6 OS=Drosophila melanogaster OX=7227 GN=Pgant6 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
265	287