CAZyme Information: MGYG000004823_02773

Basic Information

• Species: CAG-462 sp900765575
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462; CAG-462 sp900765575
• CAZyme ID: MGYG000004823_02773
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		58766.01	9.1259

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004823	3872922	MAG	China	Asia

• Gene Location: Start: 3375; End: 4922 Strand: +

Full Sequence      

MKNNFVYLFILLALLPVLLLRDYTPGNELRYLSIADEALRNGTFFAFTNQGIPYADKPPL
YFWLVMLAKGVLGKHAMWLLGLFSLLPAWVIVRTMNRWAGPEIYKDYQLTATWMMFSCGL
FLGVALFLRPDMLMCMFIILSLYTFYRMLKKEGNQRRNTVLFPVYLFLGILSKGAVALLV
PLLSTFIFLLLTKRVRSFGQYWGWKTWGILLGGCALWIGCVYMEGGAGYLNNLFVHQTVD
RAVNAFHHKEAFYYYAVTMWYAMLPWPLLIIGVIVVALYKKQFHSELQKFFLTVLLTTFV
LLSCISSKIEVYLLPAYPFFVYLAVMQLSRFKWNHWLALSVALPALAFCLSVPALLWLSG
QEHTHFLNQGILYAAAGVLTMAGIQSLRDLYDWKALDKSINTLAFGLFCALFVAGFALPK
LNRQWGYAALCREAVEVAKESQSPVSAYCAYEIHRAENMDVFLQKDVCIVTKENLVSGTL
RGVVLMFPMRELDFIRTVVPESGIHVVGYYGFVCI

Enzyme Prediction     

No EC number prediction in MGYG000004823_02773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	466	7.3e-65	0.8555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.33e-18	21	430	28	443	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	2.16e-05	56	204	1	144	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.85e-04	28	326	33	328	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam03901	Glyco_transf_22	0.001	79	364	86	367	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH86812.1	3.28e-189	1	492	1	491
QTO25703.1	6.59e-189	1	492	1	491
QLK84536.1	6.59e-189	1	492	1	491
QUU03965.1	2.31e-184	1	492	1	491
QRP88934.1	1.32e-183	1	492	1	491

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.36e-13	11	318	6	311	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q3KCC9	3.11e-10	9	422	32	447	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1
Q4ZSZ0	1.23e-09	9	419	16	423	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=arnT PE=3 SV=1
Q4K884	1.11e-07	27	315	64	351	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
B7LAS2	1.41e-07	14	473	19	477	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain 55989 / EAEC) OX=585055 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.587661	0.409658	0.000970	0.000455	0.000483	0.000772

TMHMM  Annotations     

start	end
5	24
75	92
113	146
166	188
201	223
257	279
291	313
336	358
365	384
399	418