CAZyme Information: MGYG000004824_00011

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000004824_00011
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787		90177.09	6.9735

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004824	2984736	MAG	China	Asia

• Gene Location: Start: 15119; End: 17482 Strand: +

Full Sequence      

MKKILFSILCLMISGIVTAQTFYYVSPEGKDKNPGTIKAPFKTIEKAQLKARQTKEDVII
CLREGVYRLTETLVFTPQDGNAHKSLTIRPYSHEKVVITSGTLLTPEWKPYSNGILKADI
RKGLNMDMLCVDDDIRYQARYPDYDSTAIRFNGVAADATSPERVRKWAHPEDGFLHAMHM
HDWGDFHYRITGKDTEGKLKLEGGWQNNRQLGLSRENRMVENIFEELDAPGEWFYDKRQS
ILYYYPLAKENVQDLRIESAQLKHLIELRGTQDNPVCNIIIEDIEFTQTLRTFMEKYEPL
LRSDWTIYRGGAIVFEGTEHCTLKNCYLHNLGGNAVFFSNYNRHSAILSSHFTQIGASAI
CFVGDSKAVRSPSFEYNQFIPFDKMDLEPGPLNKNYPAECLVDDNLIHRIGRFEKQVAGI
ELSMCQSITVCHNSIYDTPRAGINVSEGTWGGHIIAYNDVFDTVKETGDHGSFNSWGRDR
FWHPHRAVMDSITSNYPSIILADAVRTTIIHDNRFRCDRGWDIDLDDGSSNYHIYNNLCL
NGGIKLREGFYRVVENNILVNNTFHPHVWFPQSGDVFQRNIVMSPYQPINLNGWGATINN
NIFTDSISYQTARQYQTDSESVVYPVHFINPQTGNYQIADIDSPVFRLGFQNIRMNNFGV
RSPHLRHIALTPEFSIPTINKSVRQDKIIDWQGLQIKDLNTMGERSATGMDAERGVYIYK
SSHNKGTLSKYLYTNDVILGINGFTINNLFELRNALKQTDCKQPIRLTIIRNQQQLFITL
PANIIKE

Enzyme Prediction     

No EC number prediction in MGYG000004824_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	539	9.8e-65	0.9867172675521821

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00987	PDZ_serine_protease	3.98e-08	691	780	2	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
cd00991	PDZ_archaeal_metalloprotease	1.94e-05	725	772	15	68	PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam13229	Beta_helix	1.54e-04	311	448	1	123	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
COG0265	DegQ	0.003	628	780	190	336	Periplasmic serine protease, S1-C subfamily, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones].
cd00989	PDZ_metalloprotease	0.004	735	780	33	77	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	2.12e-210	23	756	33	773
BAU63437.1	1.12e-41	22	584	56	621
AEE97817.1	2.37e-38	23	725	441	1162
AQQ71020.1	4.71e-38	1	659	1	708
AFZ35556.1	3.83e-37	23	661	48	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	8.23e-19	24	448	28	501	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000598	0.998699	0.000201	0.000162	0.000156	0.000154

TMHMM  Annotations     

start	end
5	27