CAZyme Information: MGYG000004824_00962

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000004824_00962
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24776.57	10.0232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004824	2984736	MAG	China	Asia

• Gene Location: Start: 92853; End: 93491 Strand: +

Full Sequence      

MRNTILILLLLMFLPVSVSAQFYTITRDSALLPTERQKESYNRAGKDVTKGKKNKMMVKD
TLTVGSDNQKKLDDNSRNSDRKASLKTELQKKTDDITKSEIHLPELTIPNLYKEIIRNGI
LYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTESVRAYYTKVQYKY
KGGNYLLWLDEIGYAGDYNYIEKVIRIYRILD

Enzyme Prediction     

No EC number prediction in MGYG000004824_00962.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	113	209	4e-17	0.921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	6.99e-16	109	173	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	9.88e-10	117	209	60	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	2.62e-09	121	207	28	135	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	5.62e-07	127	151	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	0.004	121	163	340	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA52216.1	3.26e-121	1	211	1	211
QJR77087.1	3.67e-120	1	211	1	211
ALJ41751.1	3.67e-120	1	211	1	211
QUT98797.1	1.91e-113	1	211	1	211
QUT57866.1	2.93e-88	57	211	1	155

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000326	0.999004	0.000170	0.000153	0.000149	0.000150

TMHMM  Annotations     

start	end
5	24