CAZyme Information: MGYG000004825_01926

Basic Information

• Species: Sutterella sp900757865
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900757865
• CAZyme ID: MGYG000004825_01926
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		44297.16	5.947

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004825	2298450	MAG	China	Asia

• Gene Location: Start: 560; End: 1777 Strand: -

Full Sequence      

MMTKTTLTVTLLTSALALLTSNTWAATVNASSEPVAPVASSTVATNVPTHATVPTDGSLW
PRWVEFRTAAVEGGRVIDRSDARLITTSEGQSYGMFFALIANDRETFKAIWDWTKTNLCA
GDCAKTRVAWLWGASAPVVGNNANDGKAVTWGVIDSNNATDADLWMAYSLLDAAKRWGVA
SYRKDALALLERLKADTRVVRGLGRVLLPANVGFEKNGDVVLNPSYYPISLLKGLERVDP
FWHEVRLASLRVLYRSAESGFSPDWVAFGQRWGTRNRDEGSVGSWNAIRVYLWAGLMNPE
DPDAARLKAALRPMLEVTRAAFYTPEDTDTAANTVSTSGPLAFSACLLPWLKNDKAGAYI
RSGLAQMALTGEDYYRSVLALFAMGFDEGRYAFGEDGSLWLRDQP

Enzyme Prediction     

No EC number prediction in MGYG000004825_01926.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	60	386	2.8e-74	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	2.91e-119	38	402	8	367	cellulase.
COG3405	BcsZ	4.23e-73	58	393	24	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.70e-52	63	389	8	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	1.64e-106	60	399	71	407
QQS88762.1	2.23e-103	51	404	19	364
QDA53874.1	1.23e-102	60	402	24	361
AUJ83489.1	8.92e-89	60	399	25	356
CAD5359680.1	1.26e-88	60	399	25	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	1.56e-81	60	399	4	335	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	1.23e-79	60	399	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	3.45e-79	60	399	8	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	9.15e-79	60	399	4	339	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXF_A	2.71e-76	60	399	4	335	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	2.33e-84	60	399	26	357	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	1.85e-83	60	399	26	357	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8X5L9	2.84e-82	60	399	25	356	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	4.49e-81	60	399	25	356	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	2.10e-66	60	399	33	371	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000368	0.998907	0.000184	0.000194	0.000167	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004825_01926.