CAZyme Information: MGYG000004828_00775

Basic Information

• Species: Fusobacterium_A sp900764925
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900764925
• CAZyme ID: MGYG000004828_00775
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000004828_7|CGC2	41652.89	8.7653

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004828	2602027	MAG	China	Asia

• Gene Location: Start: 65226; End: 66299 Strand: -

Full Sequence      

MKIFVSTGEVSGDLHLSYLVETIKKKYKDVEFYGVAGNHSRRVGVNVIQDIDELAIMGFT
EVLKKYSFLKRKANEYIDFIKREKIKKVILVDYGGFNLKFLELLKQEIEDIEVFYYIPPK
LWIWGEKRIKKLIKADHIMVIFPWEVEFYKKYNVDAIYFGNPFVDKYIVEKRCEDNILLL
PGSRKQEIRTLIPIMLELVKRDTTKNFILKLSSKEHLKWIDEDLSSYPNLTLEFEKTLSE
CVKLSKVAVAASGTVTLELALMGLPTIVVYKTGFINAFIARYILKVGFVSLPNLTLNREV
FPELLQERCNVLEIEKYLIKLDENSEEMKKNIQEVRERLSGKNVVESYGDFLVKGER

Enzyme Prediction     

No EC number prediction in MGYG000004828_00775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	337	8.8e-101	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	8.17e-112	1	354	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.06e-90	1	341	2	361	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	9.17e-71	3	339	1	354	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.39e-64	3	346	8	376	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.42e-55	1	345	2	341	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ19865.1	1.15e-223	1	357	1	357
VEH39859.1	1.09e-191	1	357	1	357
AVQ31390.1	1.09e-191	1	357	1	357
SQJ09670.1	1.55e-191	1	357	1	357
AVQ26961.1	1.55e-191	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.93e-31	1	309	7	332	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.61e-31	1	309	7	332	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZVR9	1.67e-52	2	353	6	376	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
Q5WWX7	3.30e-52	2	353	6	376	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1
B2V704	5.82e-50	2	346	3	373	Lipid-A-disaccharide synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) OX=436114 GN=lpxB PE=3 SV=1
Q5X5J5	1.04e-49	2	353	6	376	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Paris) OX=297246 GN=lpxB1 PE=3 SV=1
C0QR27	3.05e-46	2	352	3	373	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004828_00775.