CAZyme Information: MGYG000004828_02155

Basic Information

• Species: Fusobacterium_A sp900764925
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_A; Fusobacterium_A sp900764925
• CAZyme ID: MGYG000004828_02155
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36726.76	9.7723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004828	2602027	MAG	China	Asia

• Gene Location: Start: 17136; End: 18098 Strand: -

Full Sequence      

MLSTPLIKKLRDTYPKAEITYLTTPVGASILRNNPYLNHIIEYDKRGEHRGIRGFWAIAK
KLKMEAYNLVITPHRYLRSSFLAFLTGAPIRRGYDIAAAKFFYNEKIHYDRSKHEVEKLL
AFVPKDENRRYEIELFPGELEKGRVDKFLEGANKNIVVVAPGSKWFTKRWPLEYFNVIIK
ELETQKDVTVVIIGGKEEQFLNIPSTKNSIDLRGRTSLLEVAEVISRAKVLLTNDSSPIH
MGSAFPKVRILAIFGPTVESLGFFPWSKNSKVFQVEELPCRPCSMHGGNSCPKKHFKCML
DIKPQVVLDEIKKELESEEL

Enzyme Prediction     

No EC number prediction in MGYG000004828_02155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	56	296	5e-48	0.9733333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.70e-64	1	313	14	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	8.99e-59	1	319	16	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.06e-29	56	295	2	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.54e-15	1	281	20	317	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ20050.1	4.77e-189	1	318	15	332
QNM16241.1	1.46e-176	1	318	15	332
VEH40950.1	1.77e-148	1	316	21	337
AVQ30469.1	1.77e-148	1	316	21	337
AVQ27559.1	5.85e-147	1	316	21	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	3.37e-14	1	257	23	290	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	1.26e-10	1	281	8	305	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	5.61e-10	1	281	8	305	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004828_02155.