CAZyme Information: MGYG000004830_01034

Basic Information

• Species: CAG-485 sp900549375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900549375
• CAZyme ID: MGYG000004830_01034
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		72271.73	8.7162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004830	2642212	MAG	China	Asia

• Gene Location: Start: 81597; End: 83516 Strand: -

Full Sequence      

MRKRSLFLLMTAAAVSTFANAQSIYPGQHRGKIAVENSAPVKAESFDLKEVRLLPGRVRE
NLERDSAWMVNVSARRMLHGFRNNAGVFAGVEGGYESVKKYGGWESLDCDLRGHTTGHLL
SAYGLMYAATGSEIFKLKGDSLVAGLAEVQQALGDKGYLSAFPEELINRNLQGKGVWAPW
YTLHKILSGLIDQYLYSGNQQALTIAKGMGDWAYGKLKDRDAETRRKMLRNEFGGINEAF
YNLYSITGNKDYKWLAEFFYHADVLDPLRQGNYDFGTKHTNTFIPKLIGEARNYEISGDT
SSRAIAAGFWENVVNHHTFASGSCSQKEHFFPVDRFSKYINGYTGESCCTYNMLKLSRHL
FSWTADPAIADYYERALFNHILGQQDPESGMVCYFLPLMSGSYKLYSTPEQSFWCCVGSG
FESHAKYAESIYFHNDDTIFVNLFIPSELNSETSGWQLRQATGFPYSDKSEIIIGDAPAK
NMNIALRYPAWSGQPIVKVNGKRIRVKASPSSYISINRKWKKGDKIEMTYPMALRLEATS
DNPDKAALFYGPVLLAGDMGSEGVKSFFSNPNVRNDYYTYDYKVPETLKDTLRIDRKNLS
TTIEAGEGKLRFVTSEGYRLRPFFDTHRTRHVVYWNLEK

Enzyme Prediction     

No EC number prediction in MGYG000004830_01034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	50	556	1.8e-191	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	50	556	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.05e-116	48	560	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00179.1	2.06e-306	1	638	1	639
QUT34119.1	2.06e-306	1	638	1	639
ALJ62034.1	2.06e-306	1	637	1	638
QUT92215.1	4.15e-306	1	637	1	638
AII64638.1	1.78e-302	3	639	2	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.09e-110	46	635	28	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.92e-105	46	635	28	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.11e-20	236	584	194	581	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.38e-19	236	584	194	581	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.85e-15	170	558	125	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001727	0.995219	0.001705	0.000810	0.000284	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004830_01034.