CAZyme Information: MGYG000004830_01681

Basic Information

• Species: CAG-485 sp900549375
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900549375
• CAZyme ID: MGYG000004830_01681
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		47890.51	5.5221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004830	2642212	MAG	China	Asia

• Gene Location: Start: 29386; End: 30648 Strand: +

Full Sequence      

MKRIFTLFAMALLCLSGILAQRYAGGDISLLPEYEKAGAKYNDYTGKLIPELLPWLHQEG
MNAMRVRLFVNPKKYKELHSADAGDTKYDPNACQDLEYIKPLCKRIVDNGMDLMLDFHYS
DTWADPAKQWTPIDWQSLNDEQLYQKIYDYTKETLEALKADGIVPAFIQPGNEISYGMLW
GPAGTSSPKKALMGSDANWARFGKLLNNAIKACREVCPKAKIVIHTERVEQTGVQKNFYD
QMKKLGIDYDIIGLSYYPYWHGDISVLANALTSLEQNYPEKKIMIVETGYSYKWALGDKD
YSSEWPLSYEGQAKYAKDLVTLLEQHPAVNGLFWWWMEYNAYGTSLQGWYNAPLFDSTNG
RATPALKEICSFAESSGVEDITTPEAEEQNRVWYDLSGRRVDNPVNPGIYVSRGRKIIVR

Enzyme Prediction     

No EC number prediction in MGYG000004830_01681.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	24	367	8.4e-91	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	1.53e-87	23	367	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.93e-75	25	381	42	402	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
smart00633	Glyco_10	0.007	208	369	111	263	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE83762.1	7.64e-136	1	420	1	416
VEH14955.1	2.69e-129	22	374	47	399
QVJ80245.1	1.37e-122	1	420	1	423
QUT66820.1	2.22e-99	2	374	4	365
AGB28452.1	2.93e-93	1	372	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.36e-53	25	379	53	401	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	5.74e-46	16	335	18	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	4.22e-45	16	335	18	320	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	4.18e-38	20	335	1	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	4.62e-37	23	347	21	328	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	1.49e-57	25	336	9	308	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	5.31e-45	16	335	43	345	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
A1D3T4	6.33e-45	23	345	25	332	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
P48841	1.95e-44	23	365	28	361	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
B0XPR3	6.76e-43	23	345	25	332	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000935	0.998015	0.000400	0.000214	0.000203	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004830_01681.