CAZyme Information: MGYG000004833_01121

Basic Information

• Species: UBA5446 sp900752445
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp900752445
• CAZyme ID: MGYG000004833_01121
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		57392.21	5.6688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004833	2201859	MAG	Sweden	Europe

• Gene Location: Start: 47; End: 1603 Strand: +

Full Sequence      

MVRALAEHYRDERRIVAWQIDNELGHESSDKCWCENCRRGFAAWLGHKYGDITRLNCAWG
TAFWGQQYGAFDEVPVPAETFAAHNPALRLDWERFCSAKIVDFAAMQARIIRELIPGAVI
THDFPGGGPGKTLDYISVAALLDRVSYNNYPVWGGQMTPLPPSEIAFGLDHMRGLKGESF
WITEAIMGAQGHDLTGCLPRPGQAKLWSWQAMAHGCEGLLYFRYRGAARGAEQFCYGIID
PDNVKGRRFYEAQSFFREVREFEAELKAPIRSDVALLYDYDSLASLRIQPQSPLLDGGRE
LRRLHSALYHCGLGVDVIPAQRDFSGYKLVLAPCMAVTDADFRRRLCEYVEGGGVAVLTF
RTAVKGKDNELVFGERLPVGLGELLGMYVEGSESTDSPDAFELTGGGRAGVFREMLVPTT
ARTLYGYADEFYGGFAAVTLNDYGRGTTCYIGTAPDDRTLDAIVKSAALRAGLEPQALPE
GVELVRRGRLSILMNHNSRPAEALGWSLAPFEVKTLLD

Enzyme Prediction     

No EC number prediction in MGYG000004833_01121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	1	260	6e-82	0.6873315363881402

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	5.66e-85	1	261	115	375	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	7.42e-81	1	502	137	640	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam08532	Glyco_hydro_42M	6.62e-43	272	474	1	207	Beta-galactosidase trimerisation domain. This is non catalytic domain B of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. This domain is related to glutamine amidotransferase enzymes, but the catalytic residues are replaced by non functional amino acids. This domain is involved in trimerisation.
cd03143	A4_beta-galactosidase_middle_domain	1.34e-20	274	416	1	145	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ99503.1	9.97e-199	1	511	120	642
ANU45745.1	9.97e-199	1	511	120	642
QIX93296.1	8.06e-198	1	511	120	642
AVQ18862.1	2.63e-188	1	516	120	647
QNM14994.1	6.16e-184	5	514	124	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LVW_A	5.15e-81	1	498	120	639	PolyextremophilicBeta-galactosidase from the Antarctic haloarchaeon Halorubrum lacusprofundi [Halorubrum lacusprofundi ATCC 49239]
1KWG_A	4.94e-69	1	503	119	619	Crystalstructure of Thermus thermophilus A4 beta-galactosidase [Thermus thermophilus],1KWK_A Crystal structure of Thermus thermophilus A4 beta-galactosidase in complex with galactose [Thermus thermophilus]
3TTS_A	4.60e-65	5	498	132	637	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
6Y2K_A	1.36e-61	1	498	120	626	ChainA, beta-galactosidase [Marinomonas sp. ef1]
4OIF_A	5.71e-54	3	458	138	601	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D9SM34	3.69e-84	1	499	120	612	Beta-galactosidase BgaA OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=bgaA PE=1 SV=1
B9LW38	2.82e-80	1	498	120	639	Beta-galactosidase Bga OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) OX=416348 GN=Hlac_2868 PE=1 SV=1
P94804	4.70e-73	1	500	120	625	Beta-galactosidase BgaH OS=Haloferax lucentense (strain DSM 14919 / JCM 9276 / NCIMB 13854 / Aa 2.2) OX=1230452 GN=bgaH PE=1 SV=2
Q8GEA9	3.38e-72	1	503	119	619	Beta-galactosidase BgaA OS=Thermus sp. OX=275 GN=bgaA PE=1 SV=1
O69315	2.71e-68	1	503	119	619	Beta-galactosidase OS=Thermus thermophilus OX=274 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004833_01121.