CAZyme Information: MGYG000004838_00885

Basic Information

• Species: RUG023 sp900315435
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; RUG023; RUG023 sp900315435
• CAZyme ID: MGYG000004838_00885
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		69122.14	5.5959

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004838	1853088	MAG	China	Asia

• Gene Location: Start: 905; End: 2743 Strand: -

Full Sequence      

MVTDPALDGRHCMEQQRIAAPGLKKAVPVLRAGETDWKDYTVTVELRPAIDSQISGIAFR
YQTSMMHYGFFLVKGGVELHRVNKLERTVIANAALSWSTDEFHTLSVTVKGNHFSCFLDG
TLVMEATDETWKEGCIALSASIPTQYRSVVVTMPEGAWKELEACRAAHSEAVKRKAATYP
KAKLWKTIDLKDFGGGRQIRFGHLTGTKETFFVICQNQRRVYKDRYPFISCMTAVSFDTG
NVLWQIGEPNKKDDTTMLTTDLPFQVYDINGDGKDEVICSWDSQLMVLEGATGNVLKRMP
TPLNDQDPATVTGLEFGTYASSRLNVDAIRIVNVSGNKRPSDILIKDRYSRIWIYDKDFH
PLWKFSHYNTGHFPYNYDFDGDGKDEIFSCYNMIDHDGKLLWSLPITVDHTDEIIVGRFN
PDDPDEEIAIVSGWEGFMILDKHGTILKRDINGHAQRISIGNYLPERRGLEICTTTYWGN
NAIIYMHDCKGNELWHKELLCNGNIITPVNWDGSGTDLILLNGDVTHGGLVDGNGDVMVR
LPDDGHPTLCSEVLDVTGDSRPEILCWDNKRLCIYTQDGEAKPNRKGVYDPEGYAVYNAS
NYRGEFSFPRWR

Enzyme Prediction     

No EC number prediction in MGYG000004838_00885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	285	582	2.6e-23	0.5016501650165016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	5.14e-10	263	576	177	527	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO10816.1	2.55e-279	1	608	57	660
ADY12054.1	1.02e-265	1	611	58	666
AGC68608.1	4.76e-252	8	612	65	667
ANW98952.1	4.76e-252	8	612	65	667
ANX01481.1	4.76e-252	8	612	65	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	2.28e-06	264	576	188	536	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	5.31e-06	264	576	185	550	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998752	0.001228	0.000044	0.000002	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004838_00885.