CAZyme Information: MGYG000004838_01028

Basic Information

• Species: RUG023 sp900315435
• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; RUG023; RUG023 sp900315435
• CAZyme ID: MGYG000004838_01028
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
264		28629.36	4.8397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004838	1853088	MAG	China	Asia

• Gene Location: Start: 49; End: 843 Strand: +

Full Sequence      

MKDSPFWTLHPVFSVGLKLRNITIDNPADAPNTDGIDIDSCRDVEVDHCHVHVGDDGIAI
KSGVGEDALEVAFPSSNIYVHDCVVEAAHGGAVIGSETGCGGHDVRVENCTYIGTDRGVR
IKTRRGRAGDIHGLSFKRLKMENVLCPITVNMYYVCGSKDERLFSLEKQPVTDTTPHIYD
VEIEDIEASGVRSACGFIVGLPEAPITGLSIKNCRFSLADEKDLVDPELASMSQGLPPAK
SRGIRLRNVEVKFENIVGAPVDQE

Enzyme Prediction     

No EC number prediction in MGYG000004838_01028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	1	228	2.5e-56	0.6030769230769231

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	4.01e-45	1	208	256	468	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	4.29e-24	2	154	104	250	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	4.86e-18	17	159	226	360	polygalacturonase ADPG
PLN02793	PLN02793	1.21e-17	21	159	215	344	Probable polygalacturonase
PLN03003	PLN03003	1.33e-16	3	161	158	308	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV29746.1	3.83e-91	1	256	180	434
ADY14832.1	2.97e-90	1	256	180	434
AEE17954.1	3.75e-90	1	256	180	437
AEC01281.1	2.25e-88	1	256	180	434
QTQ10970.1	2.21e-83	3	258	194	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	7.03e-24	3	136	210	343	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
1BHE_A	1.48e-13	3	154	171	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
1HG8_A	4.22e-06	16	144	142	267	Endopolygalacturonasefrom the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	8.89e-39	1	254	40	288	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	7.43e-27	3	238	219	449	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
Q9FY19	4.34e-16	1	222	202	407	Polygalacturonase OS=Juniperus ashei OX=13101 GN=JNA2 PE=1 SV=1
Q7M1E7	8.01e-16	1	222	201	406	Polygalacturonase OS=Chamaecyparis obtusa OX=13415 PE=1 SV=1
Q9LW07	3.27e-15	3	160	158	307	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004838_01028.