CAZyme Information: MGYG000004840_00079

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004840_00079
• CAZy Family: GH36
• CAZyme Description: Alpha-galactosidase AgaA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740	MGYG000004840_2|CGC1	84610.5	4.8581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004840	1485842	MAG	China	Asia

• Gene Location: Start: 8705; End: 10927 Strand: +

Full Sequence      

MSIHVNEDQKLFHLQTAKTSYIFKILENGNAGQFYYGPRIPVKDDYANLASREEHDCTNT
LTVEQSDFQLELIKQEYAGLGKGDYRYPAYQITYLNGSRTSEFTYTGYKITNGKQRLADL
PSSFDDRGDDAQTLTVEFKDELANVILELHYTVFKKEDVIVRSATYTNHGEPITLNRALS
TQLDLPDSDYDMLQFSGSWARERHLIRTHLRSGVQSISSLRDASSHQQNPFFILARPHTD
NNQGSATGFNLIYSGNFLDSVEVDQFDTTRVLVGINPDEFAWHLDDGESFQTPEAVMSYT
ADGLNQLSQQLGAFYQDHLINPHFAHEERPVLINNWEATFMDFNEQKLMPIVDKAHELGI
EMFVLDDGWFGHRDDDKSSLGDWFVDEKKFADGIDGFANAVHAKGMKFGLWFEPEMISLD
SKLYESHPDWMIATPGRQSTPARNQFVLDMSRSEVVDYLVDHISAIIKKTKLDYIKWDMN
RNITEMYGNQLPADRQLEFAHRYILGVYQLYARLTKAFPNVLFESCASGGGRFDLGMMYY
APQAWCSDDTDAIERIKIQDGTSYGYTQSMWGAHVSAVPNDQVGRLTSIDTRAAVAYFGD
FGYELDITKLPEDQLATIKKQVAFYKQYRHLFQFGKFYRLENPDTNNDNVYGWQVVNADK
SVAIAARFQILNGANPAYIRVYFAGLDPEKTYTVNDGQEKFSGAELMHVGYFVPRIMDRT
KPEKDPSDFSSRLFVVKEAY

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	711	3e-277	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	11	738	3	686	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	289	635	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	3.18e-141	328	627	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	3.42e-109	29	285	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	3.61e-21	653	735	4	77	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFV00427.1	0.0	1	739	1	739
AMS07491.1	0.0	1	739	1	739
QFS33587.1	0.0	1	738	1	739
QZN93310.1	0.0	1	739	1	739
QFG72053.1	0.0	1	739	1	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3MI6_A	0.0	2	736	2	734	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
4FNQ_A	1.22e-233	1	714	1	711	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	1.97e-232	1	714	1	711	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	1.81e-230	1	714	1	711	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	2.56e-230	1	714	1	711	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ALJ4	1.08e-231	1	714	1	711	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
P43467	1.91e-217	3	714	4	714	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G1UB44	2.10e-216	3	714	6	715	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
G4T4R7	4.07e-188	1	714	1	704	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
P27756	9.58e-178	11	710	9	700	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004840_00079.