CAZyme Information: MGYG000004840_01038

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004840_01038
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		41286.99	6.9846

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004840	1485842	MAG	China	Asia

• Gene Location: Start: 6483; End: 7601 Strand: +

Full Sequence      

MKKPFIIGTVAALTIANTGVTGIASTLDNPRQEAEHVIVDQVPADEQEIQERGPAYADEF
LAAFHQLSTTYEQAFRQGVADAEQGYRRAPGGSNLVEVAYQRGWERGQQLIAAASPVVPP
TQSPAPAVPSFDPEQSLPPTTDLPADQGSYEVQKPTNSQRLFINRLATVAQQVGAEYDLY
PSVIIAQAALESDWGNSRLGRAPFHNLFGVKGYFAGQTTSQVTGEYQDGRHLMIVDNFRR
YQNDYEALQDYAQTLQVPLYRGVHRQNAPTYRQATHALQGRYATDPQYEQKLNQLIEGYQ
LTRYDHQPRQSESGHQSPVKVKVTESQVPKSMRHPKPAHRKADHHHFPTIISIAGGAGSA
GLIELGRRIFFK

Enzyme Prediction     

No EC number prediction in MGYG000004840_01038.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	168	301	5.7e-30	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.91e-49	156	305	40	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.12e-47	122	306	288	473	amidase domain-containing protein.
PRK06347	PRK06347	2.12e-38	14	305	30	303	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	3.11e-30	156	305	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	4.54e-30	108	313	95	309	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFV01117.1	1.83e-150	1	372	3	382
QZN92542.1	6.66e-90	1	368	1	359
AWD62747.1	1.85e-74	143	369	105	332
QFS34532.1	1.87e-74	1	363	1	342
AGR64497.1	2.28e-74	143	372	111	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.78e-39	159	305	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	1.66e-27	146	305	48	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.35e-14	162	297	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.87e-14	162	297	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.84e-12	167	301	13	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RHZ5	1.11e-33	140	305	43	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	7.95e-33	140	305	43	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	2.03e-32	140	305	43	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P37710	8.73e-32	127	305	148	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.91e-28	162	305	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.031423	0.932093	0.035472	0.000447	0.000294	0.000243

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004840_01038.