CAZyme Information: MGYG000004841_00889

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000004841_00889
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42395.55	8.1963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004841	2009543	MAG	China	Asia

• Gene Location: Start: 74774; End: 75898 Strand: -

Full Sequence      

MKKLFIITGEYSGDIHAANVVRELRALESDIEIEGIGGDNLAAQGVKLFANQDKMSAVGI
SPKILFDHYKLGKSVVEYLTNEYKPDLVLLIDYGAFNLSVAKFLHAAGIKVYYYIPPQVW
ASRKYRINLIKKFVDKVLCIFPFEKPLYAQYGIDTHYCGHPLVAQLPAPVYRKEFFEKHG
FDVNKKLVSVFPGSRVFELKQLMNIFKESVKQLQAKHPDLQFCMSHAPNLSDEIYNKYLG
DCDIKVIKGENQALLSVSDALILASGTVALEACLYKTPMIIAYRGPRLFYWIYLLVRCIK
RVSLPNIIADKEIVPELIQDKATPSNIVFEIEELLYNSEKREKNIKELGVVKDLLSDKNS
ALEVAKVIDTTLFS

Enzyme Prediction     

No EC number prediction in MGYG000004841_00889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	352	2.6e-107	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.25e-124	1	370	1	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.14e-106	1	368	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.11e-81	4	343	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.46e-68	6	344	10	354	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.63e-46	1	369	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.59e-190	1	374	1	374
AEH45383.1	8.28e-75	3	367	10	371
AKQ33376.1	4.87e-73	2	367	6	371
QMU61387.1	4.81e-72	4	367	13	379
QVW66337.1	6.92e-71	3	366	6	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.98e-44	6	337	11	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.98e-44	6	337	11	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.38e-71	3	366	6	372	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B6J9H1	8.94e-71	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
B6J161	1.78e-70	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	2.51e-70	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9KC41	2.51e-70	2	374	4	376	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004841_00889.