CAZyme Information: MGYG000004841_01830

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111
• CAZyme ID: MGYG000004841_01830
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000004841_16|CGC1	39393.96	8.0097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004841	2009543	MAG	China	Asia

• Gene Location: Start: 26945; End: 28000 Strand: -

Full Sequence      

MEETEKKQKLLLIKLSSLGDVIFNVPLANALKDAGYEVTWLVSEKGIQIVENNPCVDKAI
LVPIKKWKERGFCLENFKEYLAILKQIRAEKFDIAIDSQMMLKSLYWLLFCGAKRRIISK
EGRELSVLGGNEWIDDISYAPNSPIVLNYLKYAEHLGIKPDSIKVSLPPRTEEQINKVNE
LLSNLDPQKPLVVIAPATTWANKHWNKDNWKMVVESIGEKCNLVFTGGPNDNDLIEYISD
GKYLNLAGKTDIMELMEIFSRANLVMAPDSGSAHLAWATGKPAIITIFTCTPKEVLAPFG
NPNKYVAMGGEGLPCQTCFKRKCKLKKNINACTNFPNPKDVIDTINTLIFS

Enzyme Prediction     

No EC number prediction in MGYG000004841_01830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	82	328	3e-45	0.9688888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.24e-44	19	349	13	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	6.15e-44	19	346	11	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	4.91e-34	81	327	2	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.08e-11	19	291	17	291	lipopolysaccharide core biosynthesis protein; Provisional
PRK10964	PRK10964	1.89e-10	19	288	12	279	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38472.1	1.64e-131	8	349	2	346
ACI21302.1	1.89e-43	8	345	6	326
ACL70637.1	2.34e-42	2	323	426	753
ADQ15545.1	2.14e-41	5	323	4	326
BBM87885.1	4.67e-41	8	342	4	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.44e-06	15	284	16	284	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.42e-18	4	308	5	301	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004841_01830.