CAZyme Information: MGYG000004845_01472

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; UBA4716
• CAZyme ID: MGYG000004845_01472
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912	MGYG000004845_12|CGC1	98286.11	4.1399

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004845	2789282	MAG	Sweden	Europe

• Gene Location: Start: 23261; End: 25999 Strand: +

Full Sequence      

MKFKTAAALLCTAAIAASSAAAIPASVFNTGFAENVSLSEAQSPVITEAAGGLESAYVQW
TNTAQADGYNVYVKGGDFGEYTKIDDELVRYYGSYYRADVLGLKPGIYTIKVAAVSDGQE
TAVETSQLEVKSHIREGFAFSENSPNAGKAPGGYNDDGSVPEDANIIYVTAENAKTVKAT
VYENGKPHECTGLEEILQYLAKNKDPRHHIIRIIGTVTREDVDVAGDYALNSNGYLVLKG
CSNVTLEGVGNDATLKNIGILIRNSQSVEVRNLGLMLFADDGISIDTDNTNTWVHNNDVF
YGMPGKDADQVKGDGSIDCKLSKYVTISENHFWDSGKAALVDAAPTLDYDSQSDYITYHH
NWFDHSDSRHPRIRHATVHIYNNYFDGNSKYGTGVTSGASAFAEKNVYRNCNHPFYSSEQ
GSEGGNSLSNEAGGIIKAFDNLIEGGEEIIYASAENKNDFDAYLASSRDEKISSDYTTKL
STFEGETYPNTYDNFDTDPEVMYDYTPEETSTVVDTVTTYAGRGKDADFKYTFNNDEADE
SHDIDQNLKDMLLAYESSLMSSYTGASGEVYPATGADVTPPPKPTNTAAPTNSPVPTQDP
QQTQDPQLALTPVTEKTVWTFEDAADEYTSAAVLNNAKIYADATNNVRTDKPKFDTQYTK
ILKLKGSAKPGQYSTVGIIPGKTGTVEVRFENTNATSERYMCAFDENGNEIANQPAMGAA
ATLTVKVTDEYVNKEMQFGSRSSGLSLCSITFTPDGDPEASPETSPEASPEASPEASPEA
SPEASPETSPEASPEASPEVSPEASPETSPTSQPEYNYTITSGVVMGGNITAEYESSEEE
AGAVWYIAQFDDNGRLVGVSSGSITEESGEFSADRISGAARAAAYIWNTQSEPQALMRNI
PIKTGVVEQPVS

Enzyme Prediction     

No EC number prediction in MGYG000004845_01472.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	222	410	1.8e-41	0.905940594059406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	8.42e-60	135	525	34	343	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	5.39e-32	242	412	16	190	Amb_all domain.
pfam00544	Pec_lyase_C	1.67e-17	242	408	34	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
pfam05616	Neisseria_TspB	3.24e-08	660	815	257	391	Neisseria meningitidis TspB protein. This family consists of several Neisseria meningitidis TspB virulence factor proteins.
TIGR00601	rad23	9.70e-07	756	829	85	155	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF55382.1	2.65e-161	46	561	87	593
AQR94278.1	5.27e-161	46	561	87	593
AQS15728.1	8.85e-160	28	561	44	569
AGX44552.1	8.85e-160	28	561	44	569
AQS01745.1	8.85e-160	28	561	44	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.09e-20	243	410	80	248	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1VBL_A	2.67e-15	242	408	132	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
1AIR_A	1.61e-14	223	525	70	342	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]
2EWE_A	3.84e-14	223	525	70	342	ChainA, Pectate lyase C [Dickeya chrysanthemi]
5AMV_A	4.69e-09	242	407	134	324	Structuralinsights into the loss of catalytic competence in pectate lyase at low pH [Bacillus subtilis],5X2I_A Polygalacturonate Lyase by Fusing with a Self-assembling Amphipathic Peptide [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65DC2	1.44e-22	183	421	58	288	Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=BLi04129 PE=3 SV=1
B1B6T1	1.44e-22	183	421	58	288	Pectate trisaccharide-lyase OS=Bacillus sp. OX=1409 GN=pel PE=1 SV=1
Q8GCB2	1.44e-22	183	421	58	288	Pectate trisaccharide-lyase OS=Bacillus licheniformis OX=1402 GN=pelA PE=1 SV=1
Q5AVN4	3.92e-18	242	421	98	277	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
Q4WIT0	9.42e-17	242	421	92	271	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999066	0.000150	0.000191	0.000155	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004845_01472.