CAZyme Information: MGYG000004847_01789

Basic Information

• Species: UMGS1670 sp902406135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Anaerotignaceae; UMGS1670; UMGS1670 sp902406135
• CAZyme ID: MGYG000004847_01789
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384		43719.01	4.4492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004847	2381643	MAG	China	Asia

• Gene Location: Start: 33589; End: 34743 Strand: +

Full Sequence      

MGLKKILCASLCLVTVLSNTAFAQETKEYVSDSIKVIKDGTEMTVQACNIDGYNYYKLRD
LAEITGFNTDWDAVNSAVIINTENDDITPWKYQSMLGRGMDVDWSKTKQGTENYNEQTVI
DFASAGVSHVRIRIADDISDELLESLDKQINDCLNHGIIPIIAYQADDFKNDPSEENIAH
AVNWWKTVAERYKDYSKLLSFDLLIEASDSINKQPDKLNEYYERAVTEIRKTNPERIIFI
SPIVRSDPAYLSELKIPTDHNGYLMAEWHFYAAGPSKTNEKKLWTTGTDEEKALITDKIN
TALKWQEETGIPTWVGAWMAGNYNDGDDYSVKEQVVFATFMTESLDNAGIPFAVNSDTKF
YDREKNKWIGKMEPLRYAVYGNNL

Enzyme Prediction     

No EC number prediction in MGYG000004847_01789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	97	353	2.5e-28	0.7818181818181819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.68e-18	110	343	20	258	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB28168.1	1.92e-150	87	382	5	300
QUF84801.1	2.33e-147	87	379	29	321
QMW91197.1	3.31e-147	87	379	29	321
BBK76626.1	3.31e-147	87	379	29	321
AXB85103.1	1.34e-146	87	379	29	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4U5I_A	1.57e-17	104	364	103	365	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5I_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_A Chain A, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U5K_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
4U3A_A	6.99e-17	104	364	103	365	ChainA, Endoglucanase H [Acetivibrio thermocellus ATCC 27405],4U3A_B Chain B, Endoglucanase H [Acetivibrio thermocellus ATCC 27405]
3AZR_A	7.06e-16	87	346	3	277	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
6UJE_A	9.84e-16	121	316	39	250	ChainA, Endoglucanase [Clostridioides difficile],6UJF_A Chain A, Endoglucanase [Clostridioides difficile]
3AMC_A	3.19e-15	87	346	3	277	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	1.28e-20	104	368	53	319	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	8.45e-16	104	364	354	616	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999102	0.000183	0.000153	0.000154	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004847_01789.