CAZyme Information: MGYG000004848_00794

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_00794
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000004848_8|CGC1	36513.37	7.8148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 36637; End: 37614 Strand: -

Full Sequence      

MKKLLSFIFAAMCAFTANAANPYDNPDTLVVARDGTGQFRTINEAVEVCRAFMEYHKVIY
VKKGVYKEKVIVPSWLTNIEVCGENAENTIITYDDHANIRFKETGQPMGTFRTYTVKVQG
NYITFKNITIENNAARLGQAVALHTEGDHLVFINCRLLGNQDTVYTGVANTRIYFKNCYI
EGTTDFIFGPSTAWFEGCIIHSKQDSYVTAASTPADVTYGYVFNNCKLTAAEGVTKVYLG
RPWRPYAYTLFMNCELGSHIVPCGWHNWGKASNEETARYAEYNNSGAGASTKNRTSWSKQ
LTKKEAAKVTLENVFKIDNSWIPEI

Enzyme Prediction     

No EC number prediction in MGYG000004848_00794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	7.8e-102	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	3.09e-80	30	310	3	290	Pectinesterase.
PLN02773	PLN02773	2.52e-76	29	308	7	289	pectinesterase
PLN02682	PLN02682	8.01e-69	28	306	70	352	pectinesterase family protein
PLN02197	PLN02197	8.31e-64	28	324	276	579	pectinesterase
COG4677	PemB	3.81e-63	14	316	61	403	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	2.74e-174	1	325	1	325
QVJ81978.1	2.34e-172	1	323	1	322
ADE82952.1	2.34e-172	1	323	1	322
QJR97878.1	4.30e-167	12	324	5	319
AGB28242.1	1.47e-159	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	6.94e-45	29	322	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.51e-39	30	322	6	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	6.35e-39	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.42e-38	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	9.34e-26	39	325	18	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	4.61e-53	28	324	272	575	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9LVQ0	1.85e-52	31	306	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	3.55e-52	33	322	90	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q5MFV6	7.05e-51	28	309	276	562	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	7.56e-51	28	324	259	562	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999099	0.000197	0.000155	0.000144	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004848_00794.