CAZyme Information: MGYG000004848_00803

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_00803
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000004848_8|CGC2	43320.03	8.3883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 49383; End: 50537 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASRLMQSLRRVDGEAEFRFFGGDLMSAAGGMRVRHYRDLAYMGFV
PVLLHLRTIFRNMAFCKRDITEWHPDVVILVDYPGFNLDIAKFLHAKTSIPAYYYISPKI
WAWKEYRIKNIKRDVSELFSILPFEVPFFEGKHGYKIHYVGNPTADEVSGFLKTYTDSYD
EFCSKNGLDSRRPVIALLAGSRKQEIKDNLPAMIEAASRFADKYQLVVAGAPSISADYYA
GFISGQPVKIVYGQTYELLAHSRAAVVTSGTATLETALFNVPQVVCYETPIPKVIAFLRK
HLLKVRYVSLVNLIADREVVRELVADTFSVDNIAAELSRLLPDGACRSSMIDGYAEVRRR
LGDKIAPDNAAEIMVRLLKKEVDE

Enzyme Prediction     

No EC number prediction in MGYG000004848_00803.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	361	2e-112	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.02e-111	1	381	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.06e-99	1	380	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.88e-68	4	344	2	342	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.23e-62	5	372	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.41e-47	1	333	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB72247.1	2.19e-191	1	378	1	376
APW34950.1	2.37e-189	1	381	1	379
AFJ08027.1	2.37e-189	1	381	1	379
BAR95292.1	2.37e-189	1	381	1	379
QUB73930.1	3.31e-189	1	384	1	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.84e-33	5	377	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.02e-32	5	377	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	3.16e-66	5	381	11	383	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	4.33e-66	5	378	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
C1F718	1.35e-65	4	361	8	371	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q74AT9	1.49e-63	5	382	11	384	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1INL4	1.99e-63	1	376	2	372	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004848_00803.