CAZyme Information: MGYG000004848_01661

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004848_01661
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000004848_29|CGC1	65455.78	6.565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004848	2237652	MAG	China	Asia

• Gene Location: Start: 8241; End: 10031 Strand: -

Full Sequence      

MKKLFFTVIAALCCHLTAPAGDIFISPTAGNDKAAGTREAPLKTLEQALKQAREWRRLGS
KNAEGGINIIMGGGVYRLYKPLFIRPEDSGTANSPTIIRSADGEKAVISGGTVVTGWRKG
SDDPRLPAGVRGKVWVADAPMAGNRMVETRQLWAGGRKAVRASQFAYGVMERMKAFDTTD
ESITIPKPKTDLSRARQLEMVVHQRWAIAILRVREIKDMGNGLSKVWFHQPESQIEFAHP
WPQPVIDGERGSSSFFLTNALELLDEPGEWYQDYPSGRIYYYPEDGKDPNTMDITVPVLE
TLVTIGGTRERHVSNIRFDNVAFEHSAWRRPLYEGHVTLQGGFRFIDGYKLAEPGLFHKA
ELENQAWIARPEAAVTAQFADSIGFGSCTFSHIGATAVDLAYAVSSSDITGCTFTDIGGT
AIMAGWFGEQGFETHIPYTPAIDGDMCNRLTISRNKITDAANEDWGCGAVSAGYVRDTEI
SGNEVSHVNYSGICVGWGWTPLESGMRNNRITGNTVTDYARQLYDAGGIYTLSNQPGSVI
SGNTISMPHPAPYATNHRAFCIYFDEATDGYTVSGNKMPEESFGYNRPGKNLKIIK

Enzyme Prediction     

No EC number prediction in MGYG000004848_01661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	22	580	6.7e-188	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	4.54e-10	388	577	16	157	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.08e-07	441	576	2	108	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	5.93e-06	409	576	5	147	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	2.48e-04	394	544	56	171	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	5.21e-04	468	578	1	87	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42515.1	1.76e-272	1	594	1	595
QJR76527.1	5.07e-251	1	589	1	588
AII69040.1	9.46e-251	1	589	1	588
QUT84057.1	9.46e-251	1	589	1	588
ALA74807.1	2.82e-250	1	589	32	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	5.08e-159	15	589	20	593	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000381	0.998871	0.000264	0.000160	0.000152	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004848_01661.