CAZyme Information: MGYG000004849_00453

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000004849_00453
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729	MGYG000004849_10|CGC2	81583.04	4.8668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004849	3246607	MAG	China	Asia

• Gene Location: Start: 23311; End: 25500 Strand: -

Full Sequence      

MTHTELFSNACWVAPSIPCSQPYLRSVFTASGGEKASITISGLGFFELYCNGKRVSPDLL
TPAWTDYESHLFAHCMSGNPVQETRGHRVLAMRYQLTGLLRPGKNVLGIRLGSGWYEFFG
YGSVKACFRLTLAGEDCDAVVSSGADMRWAPSPIVKSQMLKGEIHDYFLEIPGWADPDFD
DSTWATVQEVPAPESDFHIQECPADRVIRSIEPKLLREENGLRLYDAGENIAGYAVLSCP
EGSSGETVVRYAEELGEDGWLDFTTYNYNQEERIHEDRFLLDGKARELYPRFLWHGFRYF
TVSGDIAAVRVAVTNANVPVTSSFTSSNPDLNWLYDAYIRTQLANMHAGIPSDCPHREGQ
GYTGDGQLTCETVMTTLDARKFYEKWMADISDCQCRETGHIQYVAPYTPCGGGPGGWGCA
IIVVPYTFYRQYGDVSVLEQYYPQMRRYLDYLESHSDDDLVTREDPPEAWCLGDWCTPDE
IAIPEPFVNTYFYIKSLLRMKEIARILGRLEDIPTYQAIEERKRAALLRTYYDPSTGSFA
GGIQGADAFAADIGLGDVRTFQSLLTKYRTLGMYDTGIFGTDILTRILFERGEGQLAYDL
LASRKETSFHTIRTKGATTLWEYWTGYASHSHPMFGAVVRYLFQYLLGIRQTEESAGFTR
IIIAPVLPDGLDSASGSMTAPQGKITVSWSKTPGGTAFTVELPANIDAEFRCGALCRKLK
PGKTELFLQ

Enzyme Prediction     

No EC number prediction in MGYG000004849_00453.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	218	710	3.8e-123	0.9880952380952381
CBM67	20	193	8.9e-19	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.73e-79	321	646	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.06e-32	34	209	4	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	4.19e-10	648	709	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.09e-08	224	309	9	91	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	4.33e-213	7	729	3	725
BCJ98018.1	2.83e-156	12	709	127	855
QOY86540.1	7.40e-138	18	726	150	858
BCG53442.1	3.31e-117	18	708	171	868
QGA23405.1	1.21e-112	17	708	172	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.06e-84	22	709	177	895	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.74e-74	34	709	317	991	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.91e-44	36	708	147	842	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.29e-73	34	709	317	991	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.58e-66	23	709	176	875	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.24e-64	23	710	172	876	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	7.97e-63	34	708	198	902	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	1.08e-09	322	710	731	1134	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004849_00453.