CAZyme Information: MGYG000004849_00690

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000004849_00690
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000004849_16|CGC1	48048.04	4.8817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004849	3246607	MAG	China	Asia

• Gene Location: Start: 3560; End: 4837 Strand: +

Full Sequence      

MDQQQTIPSQQQLEFLDWEIGMFFHFGLRSFYPGHCDWDNLPMHAQQFAPDSLDCNQWME
AARALGAKYTVLTCKHHDGFALWPSKYTDFSVKNSPYREGNGDIVAEYTTACRRYGMKVG
LYYSPAQWGGEHSFASEDSEAYDSYFIGQLNELLSNYGTIDYLWLDGCGSEGHVFDTARI
SDAIRRLQSDILIFGSVLSPYNDNRWIGNEDGYAPLDNYNTVCQDESIVLNAARFMPAEC
DMMIRNVWFGGAPNEAYLKQPCELFGNYEYTVGRGANWLLNVGPDQHGRIPEEDFAILRE
TRRKIDAAYGPGAALPFVPVAQEGTDWCISHPEFFKGYGVTRGIPLCNRLVLMEDLSNGE
QVKSFRIYANLPMGKSHRLCIYRGDAIGHKHICAFPAIPASKFTLEITEGSGNCVIRSME
ALYVR

Enzyme Prediction     

No EC number prediction in MGYG000004849_00690.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	9	302	8.8e-71	0.8526011560693642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.16e-53	13	417	16	425	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.17e-45	15	300	22	323	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	5.09e-41	21	300	29	325	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95058.1	7.78e-117	8	423	7	415
QHW31138.1	1.34e-116	7	423	18	429
QHT59657.1	3.92e-115	7	423	18	427
ASN07285.1	2.14e-113	5	424	2	401
BBH22425.1	3.80e-111	8	424	9	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EYP_A	2.66e-57	7	309	9	323	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	1.02e-52	8	407	19	461	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	1.39e-52	7	423	31	459	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	1.07e-51	7	407	38	448	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3MO4_A	4.14e-51	8	407	21	463	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	3.28e-50	7	407	39	461	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	1.01e-49	7	424	37	478	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q99LJ1	7.11e-15	45	290	93	333	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q9BTY2	1.34e-14	48	290	107	345	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
Q60HF8	1.79e-14	47	290	111	349	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004849_00690.