CAZyme Information: MGYG000004849_02371

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000004849_02371
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000004849_119|CGC1	39112.36	5.4351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004849	3246607	MAG	China	Asia

• Gene Location: Start: 3178; End: 4227 Strand: -

Full Sequence      

MNNLPNFLLNADGRKIAPADWNRQREQIKEILQQNIYGRIPAAPDEIYAEVLETCTNYCA
GKALFQEILLTVRVGKKDASFPVFAAVPVNRQIEGTFLFLSFRTEFPNEYLPVEEIVDGG
FAVFSFCYKDVTADNDDFTDGLASLFYNDNQRRADDPGKIAIWAWAAMRVMDYLQTRKDI
DASNIMTVGHSRLGKTALVAAGFDERFSGGISNDSGCAGAAITRGKQGERIAQIVDRFPY
WFCRQYAAYAVREQDLPFDQHFLLALIAPRTLYVASAQEDLWADPQAEFAGCVAASGAYA
LLGKMGIETETFPALNHPLHAGTIGYHIRPGTHWLSRSDWQMFMAFRKK

Enzyme Prediction     

No EC number prediction in MGYG000004849_02371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	4	348	1.1e-76	0.9739776951672863

CDD Domains     

MGYG000004849_02371 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	2.11e-109	4	349	11	359
ALL53565.1	1.14e-83	4	349	13	357
QOV20253.1	2.05e-81	4	348	13	356
QNK58798.1	2.41e-80	4	349	8	369
QDV85039.1	2.50e-80	4	346	62	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	5.62e-65	4	346	7	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	8.93e-65	4	346	25	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.33e-64	4	346	36	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	2.49e-64	4	346	25	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	6.94e-64	4	346	25	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	4.37e-56	4	346	42	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
B2ABS0	1.25e-18	12	315	131	411	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
G0RV93	5.65e-17	12	303	119	396	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
D8QLP9	1.35e-16	4	303	36	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1
P0CT87	1.43e-16	4	307	111	404	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004849_02371.