CAZyme Information: MGYG000004849_02550

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000004849_02550
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	MGYG000004849_140|CGC1	96873.88	4.6635

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004849	3246607	MAG	China	Asia

• Gene Location: Start: 4515; End: 7121 Strand: +

Full Sequence      

MKISHLKTNHLENPLGYRISRPVFTWQTESSGQKQAWARIEIAADQAFSQILYDSGQRED
IACTGFQPEFDPAPRTRYFWRVTAAADNGDTAVSSHAWFETALAADGWTARWITPAFDKE
LHPVFQKSFELPEGIASARAYVCGLGIYELSVNGAKAGDEYLLPGFHAYDFWQQYQTFDI
TGLLKAGKNVLSAALGNGWYKGRFGFEDDEDECYGSAFQFICQVAVTLSDGREIVIGTGE
DWRCRPGSCLGSSIYDGETTDGSMELPGLDVFGGEEENGWTAAVLSGMRMDQLSPRMSPP
IVYQEAFQVAQVIHTPAGETVYDFGQEVTGWVEFVCRSPKGTRLTLRYGELLQDGNFCQT
NLRSAKATFTYISAGKGETVRPRFTFFGFRYLKLEGFDAPDPRDFTARVVQSALDRIGEI
ETSSPLVNRLFLNALWGQKGNFLDVPTDCPQRDERMGWTGDAQAFCATACMNLDSTAFYA
KYMHDMELEQRALGGSVPHVVPVIKKNGELLLGVDSCAWGDAAAIVPWTVYLMSGDKAQL
AEEYPSMKMWVDRIYAYDEADGGKRLWQTGFHFADWLALDNYQEPKSSMGGTDCYYIASA
YYAYSAGLTAKAAETLGRKEDAERYSRLAREVREAMVREYFTPNGRCAADTQTAYAVALY
MELTPEEMRPRLVEELRRKLRENNMKLTTGFVGTPYLCRVLSQYGASEDAYTLLLNEEMP
GWLYEVKMGATTVWERWNSILPDGSLSDITMNSLNHYAYGSIVEWMYRWMCGLNPDEETP
GFAKAVLTPRPGQGLDFARARVRTASGVYESGWERQADGSVSYSFQVPFNCEARLELPAC
AVTEVDGAAVSGPVVLRAGRHTAVTRVE

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	313	837	3.3e-168	0.996031746031746
CBM67	111	285	2.8e-27	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.79e-123	415	768	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.19e-50	135	301	3	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.28e-33	313	410	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.42e-12	772	838	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIZ07546.1	0.0	1	845	1	849
QJD85026.1	0.0	1	846	1	831
QHQ62976.1	0.0	1	834	1	838
QKS45208.1	0.0	1	845	1	830
AIF26555.1	0.0	1	843	1	831

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	4.59e-152	125	846	134	855	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.17e-135	98	839	268	996	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	2.04e-115	6	838	35	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	1.84e-138	12	838	45	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	4.78e-135	98	839	268	996	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	3.18e-132	13	839	42	880	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	3.43e-76	9	837	38	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004849_02550.