CAZyme Information: MGYG000004851_00530

Basic Information

• Species: Nitratidesulfovibrio vulgaris
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Nitratidesulfovibrio; Nitratidesulfovibrio vulgaris
• CAZyme ID: MGYG000004851_00530
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000004851_52|CGC1	28070.53	11.0558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004851	3102739	MAG	China	Asia

• Gene Location: Start: 519; End: 1265 Strand: -

Full Sequence      

MYRKNIARRHKPAQPKRSLMKVFWLCLAAIVTLAAADVLRYAVWPDVDDLVTAQPQTTAL
IEQRRGEAEDVGRTFRVRRTWVPLKRISPHLIRAVTIAEDDKFWGHEGFDVDGMEDALRR
NLEKGRLAAGGSTITQQLAKNLYLGTERSLSRKLKEAILAVRLEDALSKRRIIELYLNVV
EWGDGIFGAEEAARAHFGVAAANLSPEQSARLAAVLPNPRKWSARNPPRHIRQKTAIILS
RMERRGLI

Enzyme Prediction     

No EC number prediction in MGYG000004851_00530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	73	243	3.9e-60	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	5.86e-91	15	247	1	228	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	9.88e-73	71	243	5	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.15e-70	16	248	12	246	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02070	mono_pep_trsgly	1.04e-69	22	242	11	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.03e-50	15	248	1	236	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM27980.1	1.62e-173	1	248	1	248
AAS96769.1	1.89e-172	1	248	1	248
ADP87274.1	1.89e-172	1	248	1	248
ABB39313.1	3.12e-77	17	246	9	234
ADR33152.1	5.00e-70	27	248	8	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.04e-37	78	248	19	189	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.20e-36	78	248	19	189	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.74e-26	77	248	37	208	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
7U4H_A	1.01e-25	79	238	40	199	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5U2G_A	7.10e-24	45	241	8	202	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1K3B8	1.22e-58	20	229	1	212	Biosynthetic peptidoglycan transglycosylase OS=Azoarcus sp. (strain BH72) OX=418699 GN=mtgA PE=3 SV=1
C1D8R6	5.77e-56	55	242	35	222	Biosynthetic peptidoglycan transglycosylase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=mtgA PE=3 SV=1
Q478U7	6.31e-56	55	242	38	225	Biosynthetic peptidoglycan transglycosylase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=mtgA PE=3 SV=1
Q3SFZ8	9.21e-56	20	241	1	223	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1
Q5P6J8	2.45e-55	55	229	38	212	Biosynthetic peptidoglycan transglycosylase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=mtgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.885344	0.106281	0.001407	0.000287	0.000179	0.006511

TMHMM  Annotations     

start	end
22	44