CAZyme Information: MGYG000004851_01755

Basic Information

• Species: Nitratidesulfovibrio vulgaris
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Nitratidesulfovibrio; Nitratidesulfovibrio vulgaris
• CAZyme ID: MGYG000004851_01755
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		34473.96	5.202

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004851	3102739	MAG	China	Asia

• Gene Location: Start: 23; End: 934 Strand: +

Full Sequence      

MKELIALCRSRECRMSMVFLEDYDMEVASHLVSGCDIWLNNPRRPLEACGTSGMKAMLNG
VMQFSTLDGWWDEAYRPDNSLGWAIGKGEEYEDPDYQDFVEVQTLYNILENDIIPDFYDR
GHGGIPRTWVRRMKAALRELAPAFNSHRMVMDYAGTAYAPALHNFNELTQRDFAPARELS
EWRMDIMTKWSMLQIRNVRAQQADTLHVGDALTVEAEILLNGIDPGHIRAEIYAGHLNQD
NSFAHRELSPMQHVGQTDDGWQVFRGTTAPAEAGRYGFTVRVCPTHPRLADPHSLGLIRW
AGV

Enzyme Prediction     

No EC number prediction in MGYG000004851_01755.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04299	GT35_Glycogen_Phosphorylase-like	4.66e-91	1	235	531	763	proteins similar to glycogen phosphorylase. This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism.
TIGR02094	more_P_ylases	5.45e-76	1	160	444	601	alpha-glucan phosphorylases. This family consists of known phosphorylases, and homologs believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc.). The name of the glucose storage polymer substrate, and therefore the name of this enzyme, depends on the chain lengths and branching patterns. A number of the members of this family have been shown to operate on small maltodextrins, as may be obtained by utilization of exogenous sources. This family represents a distinct clade from the related family modeled by TIGR02093/pfam00343.
COG0058	GlgP	1.05e-49	18	170	560	713	Glucan phosphorylase [Carbohydrate transport and metabolism].
cd04300	GT35_Glycogen_Phosphorylase	1.71e-04	18	69	610	661	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	4.59e-04	14	69	473	528	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM27933.1	1.39e-224	1	303	553	855
ADP87320.1	1.39e-224	1	303	553	855
AAS96822.1	1.39e-224	1	303	553	855
ABB38223.1	2.23e-152	2	301	554	853
QLA13729.1	3.14e-143	2	301	554	853

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMW0	5.40e-61	2	301	565	863	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgP PE=3 SV=1
P9WMW1	5.40e-61	2	301	565	863	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1
Q7U078	5.40e-61	2	301	565	863	Glycogen phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=glgP PE=3 SV=1
Q9YGA7	3.27e-51	1	302	538	827	Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=malP PE=1 SV=1
O66932	1.25e-38	17	162	548	688	Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004851_01755.