CAZyme Information: MGYG000004851_02067

Basic Information

• Species: Nitratidesulfovibrio vulgaris
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Nitratidesulfovibrio; Nitratidesulfovibrio vulgaris
• CAZyme ID: MGYG000004851_02067
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		62510.05	7.2466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004851	3102739	MAG	China	Asia

• Gene Location: Start: 1383; End: 3146 Strand: -

Full Sequence      

MIPGVRPPMLFLLGAAVSGLAVLWATYALARATGNDKATGLAAGLILLSGFYFLGVTHYA
RMDLLFTAVITLSHLCMYKGWRRESAPAWLIAGYALAAVATLIKGPLGLAFPVLSSVLFV
LWQGKVRRLHNRDAVAGFAVMLVILLGWVAAAWMTGESEYLRNIFQDQIVKRATATWHHA
QPWWHYLATFPAAWLPWTLLLLTAPWGRVLRNPVRDALDTRKPEGLGTAYLWISLFSGVA
LLSAVSIKIVIYLLPLFPILAIITARCLLRLPATNSRVFYLLVSLLLFILAVGLGGVAAL
PLLPGSVRDALPPQALALLDIVAGAPVLGGVCLIFALLLFKATDRSQPRGALLTLVLFTT
VFVQPMALYTAPSLDPVMSPKAQAEIIGAHAKEGYHPLSYRVYPGTYTFYAGTQLEEITQ
RDWALLDAALSAHPRAVIAMRLDDWEQWPNRPASAREIQRQWIVDRQFVVVVTESAAPDA
AAATPEGAPAPTVETPAAAGTEGHAVPDAAPAPAVPVEAPASPAVETPATPSASPAPTDV
APAPQPEAITAPDAAAQDQPALPAMPAPQPVAPQQTGNDATAPGAPE

Enzyme Prediction     

No EC number prediction in MGYG000004851_02067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	456	1.2e-66	0.7981481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.98e-14	13	422	88	484	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.84e-12	14	279	87	345	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.73e-07	13	149	26	158	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK12323	PRK12323	1.56e-06	449	573	374	496	DNA polymerase III subunit gamma/tau.
pfam02366	PMT	3.03e-06	3	123	77	202	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABM28860.1	0.0	1	587	144	730
ADP86283.1	0.0	1	587	144	730
AAS95692.1	0.0	1	587	81	667
ABB39217.1	3.27e-157	8	479	134	601
BBD06923.1	1.44e-116	8	516	91	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.37e-06	13	271	112	367	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02R27	1.35e-16	18	276	91	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q9HY61	2.37e-16	18	276	91	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
A6V1N8	7.33e-16	18	270	91	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
B7VBN0	2.26e-15	18	276	91	340	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q3KCC9	5.53e-15	13	201	103	294	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
39	61
88	122
134	156
183	205
226	245
249	271
278	300
315	337
350	372